KEGG   Felis catus (domestic cat): 101089768Help
Entry
101089768         CDS       T02385                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X2
  KO
K06620  transcription factor E2F3
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04110  Cell cycle
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05212  Pancreatic cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101089768 (E2F3)
   04218 Cellular senescence
    101089768 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089768 (E2F3)
   05206 MicroRNAs in cancer
    101089768 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101089768 (E2F3)
   05225 Hepatocellular carcinoma
    101089768 (E2F3)
   05226 Gastric cancer
    101089768 (E2F3)
   05214 Glioma
    101089768 (E2F3)
   05220 Chronic myeloid leukemia
    101089768 (E2F3)
   05218 Melanoma
    101089768 (E2F3)
   05219 Bladder cancer
    101089768 (E2F3)
   05215 Prostate cancer
    101089768 (E2F3)
   05224 Breast cancer
    101089768 (E2F3)
   05222 Small cell lung cancer
    101089768 (E2F3)
   05223 Non-small cell lung cancer
    101089768 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101089768 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101089768 (E2F3)
   05161 Hepatitis B
    101089768 (E2F3)
   05160 Hepatitis C
    101089768 (E2F3)
   05163 Human cytomegalovirus infection
    101089768 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101089768 (E2F3)
   05169 Epstein-Barr virus infection
    101089768 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101089768 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101089768 (E2F3)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101089768 (E2F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 101089768
NCBI-ProteinID: XP_019685712
UniProt: A0A337SHI8
Position
B2
AA seq 334 aa AA seqDB search
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKKKTRYDTSLGLLTKKFI
QLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGG
MLAQCQGLSKEVTELSQEEKKLDELIQTCTLDLKLLTEDSENQRLAYVTYQDIRKISGLK
DQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGN
IPKPPSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ
EDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcccttacagcagcaggccaagcgaaggctggagctgggagaaagcggtcatcagtac
ctctccgatggcttaaaaacccctaagggcaaaggaagagctgcacttcgaagtccagat
agtccaaaaaaaaaaacacggtatgacacatcccttggtctgctcaccaagaagttcata
cagctactgagccagtcccctgacggggtcttggatttgaacaaggcagcggaggtactg
aaagtgcaaaagagaaggatctatgacatcaccaacgtgctggaaggcatccacctcatt
aagaagaagtcgaaaaacaacgtgcagtggatgggctgcagtctgtctgaggacgggggc
atgctggcccagtgtcaaggcctgtcgaaggaagtgaccgagctcagccaggaggagaag
aaattagatgagctgatccaaacctgcaccctggacctcaaactgctaaccgaggattca
gagaatcaaaggttagcttacgttacatatcaagatattcgaaaaattagtggccttaaa
gaccaaactgttatagttgtcaaagcccctccagaaacaagacttgaagtgcctgaccca
atagagagcctacaaatacatttggcaagtacccaagggcccattgaggtatatttgtgt
ccagaagagacagaaacacacagtccaatgaaaacaaacaaccaagaccacaatgggaat
atcccgaaacccccttccaaagacttggcttcaaccaactcaggacatagcgattgttca
atttctatggcgaacctttctcctttggcctccccagccaacctcttacagcagactgag
gaccaaattccttccaacctggaaggaccatttgtgaacttactgccccccctgctccaa
gaagactatctcctaagccttggggaggaagaaggcatcagcgatctcttcgatgcttac
gatttggaaaagctcccactggtggaagattttatgtgtagttga

KEGG   Felis catus (domestic cat): 101098067Help
Entry
101098067         CDS       T02385                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04110  Cell cycle
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05212  Pancreatic cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101098067 (E2F2)
   04218 Cellular senescence
    101098067 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098067 (E2F2)
   05206 MicroRNAs in cancer
    101098067 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101098067 (E2F2)
   05225 Hepatocellular carcinoma
    101098067 (E2F2)
   05226 Gastric cancer
    101098067 (E2F2)
   05214 Glioma
    101098067 (E2F2)
   05220 Chronic myeloid leukemia
    101098067 (E2F2)
   05218 Melanoma
    101098067 (E2F2)
   05219 Bladder cancer
    101098067 (E2F2)
   05215 Prostate cancer
    101098067 (E2F2)
   05224 Breast cancer
    101098067 (E2F2)
   05222 Small cell lung cancer
    101098067 (E2F2)
   05223 Non-small cell lung cancer
    101098067 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101098067 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101098067 (E2F2)
   05161 Hepatitis B
    101098067 (E2F2)
   05160 Hepatitis C
    101098067 (E2F2)
   05163 Human cytomegalovirus infection
    101098067 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101098067 (E2F2)
   05169 Epstein-Barr virus infection
    101098067 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101098067 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101098067 (E2F2)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101098067 (E2F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 101098067
NCBI-ProteinID: XP_003989698
Ensembl: ENSFCAG00000011650
Position
C1
AA seq 442 aa AA seqDB search
MLRGPRALAPAAGPPSKGLPAMSPTELWPPGLSSPQLCPATTTYYTSLYPQTVPPTAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGKPAVPEFRTPKGKCIRLDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESKDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKRQQLGQELKELMSTEQALDQLIQTCSLNFKHLTE
DKANKRLAYVTYQDIRAVGSFKEQTVIVVKAPPQTRLEVPDRSEENLQIYLKSTQGPIEV
YLCPEEVQEPDSPTKEPFPSPSPLGPIPDSTQPSSSTDPGMTEPMASPGPALTPQQALQL
PAPPPPPLPLVPLEATDSMLELPHPLLQQTEDQFLSPTLPCSSPLISFSPPLDQDDYLWG
LDGGEGISDLFDSYDLGDLLIN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgagggccccgggccctggctccagccgccgggccgccctcgaagggactgccc
gcgatgagccctacagagctgtggccgcccggtctcagcagcccccagctctgcccggcc
accaccacctactacacctcgctgtacccgcagactgtgcctcccactgcggcgcccggc
acctgcctcgacgccaccccccacggaccggagggccaagctgtgcgatgcgtgccggct
ggccggctgccggccaaaaggaagctggacctggaggggatcgggaagccagcagtccct
gaattccggacccccaaggggaagtgcattagactggacggcctccccagccccaaaacc
cccaagtcccctggagagaagactcggtatgacacgtcgctggggctcctcaccaagaag
ttcatttacctcttgagcgagtccaaggacggcgtcctggacctgaactgggcggctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggagggcatccag
ctcatccgtaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
ccgacccgacctgggaagcggcagcagctggggcaggagctgaaggagctgatgagcacg
gagcaggccttggaccagctcatccagacctgctctctgaacttcaagcacctgaccgag
gacaaggccaacaagagactggcctatgtgacttaccaggacatccgtgctgttggaagc
ttcaaggagcagacagtgatcgttgtcaaggcccctcctcagacaagactggaagtgccc
gacaggagcgaggagaacctacagatatatctgaagagcacgcagggacccatcgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccgaccaaggagcccttcccctcc
ccctcccccctcggccccatccctgactccacccagcccagcagcagcactgaccctggg
atgacagaacccatggcatctccaggaccagcgctgactccccagcaggccctgcagctg
ccagcgcctccgccaccaccactgccacttgtgcccctggaggccaccgacagcatgctg
gagctgccacacccacttctgcagcagaccgaggaccagttcctgtcccccaccctgccg
tgcagctcccccctgatcagtttctccccgcctttggaccaggacgactacctgtggggc
ctggacgggggcgagggcatcagcgacctcttcgactcctatgacctcggggacctgctg
attaactga

KEGG   Felis catus (domestic cat): 101098454Help
Entry
101098454         CDS       T02385                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04110  Cell cycle
fca04137  Mitophagy - animal
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05212  Pancreatic cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101098454 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    101098454 (E2F1)
   04218 Cellular senescence
    101098454 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098454 (E2F1)
   05206 MicroRNAs in cancer
    101098454 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101098454 (E2F1)
   05225 Hepatocellular carcinoma
    101098454 (E2F1)
   05226 Gastric cancer
    101098454 (E2F1)
   05214 Glioma
    101098454 (E2F1)
   05220 Chronic myeloid leukemia
    101098454 (E2F1)
   05218 Melanoma
    101098454 (E2F1)
   05219 Bladder cancer
    101098454 (E2F1)
   05215 Prostate cancer
    101098454 (E2F1)
   05224 Breast cancer
    101098454 (E2F1)
   05222 Small cell lung cancer
    101098454 (E2F1)
   05223 Non-small cell lung cancer
    101098454 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101098454 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101098454 (E2F1)
   05161 Hepatitis B
    101098454 (E2F1)
   05160 Hepatitis C
    101098454 (E2F1)
   05163 Human cytomegalovirus infection
    101098454 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101098454 (E2F1)
   05169 Epstein-Barr virus infection
    101098454 (E2F1)
   05165 Human papillomavirus infection
    101098454 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101098454 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101098454 (E2F1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101098454 (E2F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Motif
Other DBs
NCBI-GeneID: 101098454
NCBI-ProteinID: XP_023107088
Position
A3
AA seq 436 aa AA seqDB search
MAVAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISTAQDASAPPAPAGPAAPAAGPRD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHAAVGIGGRLEGLTQDLRQLQESERQLDHLIHICTAQLRLLSEDSDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAIDSSETFQISLKSKQGPIDVFLCPE
ESAGGISPGKTSSQGTASGEEDRAVDPATTVPPPSSPSSSPAADPSQSLLSLEQEPLLSR
MGGLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGI
KDLFDCDFGDLTPLDF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggccggggcccccgcaggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccacggcgcag
gacgccagcgccccgccggcccccgccggtcccgccgcgcccgctgccggcccccgcgac
cccgacctgctgctcttcgccacgccgcaggcgccccggcccacacccagcgcgccgcgc
cctgcactcggccgcccgccggtaaaacggaggttggacctggaaactgaccatcagtac
ctggccgagagcagcgggccagcccggggcagaggccgccacccaggaaaaggtgtgaaa
tccccaggggagaagtcacgctatgagacatcgctgaatctgaccaccaaacgcttcctg
gagctgctgagccgctcagctgatggtgttgttgatctgaactgggcggctgaggtgctg
aaggtgcagaaacggcgcatctatgacatcaccaatgtcctcgagggcatccagctcatt
gccaagaagtccaagaatcacatccagtggctaggcagccatgcagcagtggggatcggt
gggcggcttgaaggactgacccaggacctccggcaactgcaggagagtgagcggcagctg
gaccacctcatccatatctgtaccgcccagctgcggctgctttctgaggactctgacagc
cagcgcctggcctacgtgacctgccaggaccttcgtagcatcgcagaccctgcagagcag
atggttatggtgattaaggctcctccagagacccagctccaagccatagactcctcagag
acctttcagatctcccttaagagcaaacaaggccccattgacgttttcctgtgccctgag
gagagtgcaggcgggatcagccctgggaagacctcatcccaggggacagcttctggggag
gaggacagggcagttgaccctgccaccacagtgccaccaccatcatctccctcctcatcc
cctgctgcggatcccagccagtccctgctcagcctggagcaagaacctctgctttcccgg
atgggtggcctgcgggcccctgtggacgaggaccgcctgtccccgctggtggcggccgac
tcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatcagc
ctgtcccctccccacgaggccctcgactaccactttggccttgaggagggtgagggcatc
aaagacctcttcgactgtgactttggggaccttacccccttggatttctga

DBGET integrated database retrieval system