KEGG   Felis catus (domestic cat): 101089813Help
Entry
101089813         CDS       T02385                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04015  Rap1 signaling pathway
fca04218  Cellular senescence
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05135  Yersinia infection
fca05145  Toxoplasmosis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101089813 (MAP2K6)
   04010 MAPK signaling pathway
    101089813 (MAP2K6)
   04668 TNF signaling pathway
    101089813 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101089813 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101089813 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    101089813 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101089813 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101089813 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101089813 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101089813 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101089813 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101089813 (MAP2K6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101089813 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101089813 (MAP2K6)
   05161 Hepatitis B
    101089813 (MAP2K6)
   05163 Human cytomegalovirus infection
    101089813 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101089813 (MAP2K6)
   05169 Epstein-Barr virus infection
    101089813 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101089813 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101089813 (MAP2K6)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101089813 (MAP2K6)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE7 family
   101089813 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase Pkinase_fungal Choline_kinase DUF4344 CLP1_P APH
Motif
Other DBs
NCBI-GeneID: 101089813
NCBI-ProteinID: XP_003997157
Ensembl: ENSFCAG00000015681
UniProt: M3WN25
Position
E1
AA seq 334 aa AA seqDB search
MSQSKGRKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPGDKFTEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaggaagcgaaaccctggccttaaaattccaaaagaagcattt
gaacaacctcagaccagttccacgccacctcgagacttagactccaaagcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgatctggaaccaataatggaactgggg
cgaggtgcgtacggggtcgtggagaagatgcgacacgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacagtaaatagccaggagcagaaaaggctactgatggatttg
gatatttccatgaggacagtggactgtcctttcacagtcaccttttatggtgcactcttc
cgggagggtgatgtttggatttgcatggaactcatggatacgtcgctagataagttctac
aaacaagtgattgacaaaggccaaacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaggcgttagaacatttacacagtaagctctctgtcattcatcgagacgtc
aagccttccaacgtgctgatcaacactctgggccaagtaaagatgtgcgattttggaatc
agtggctaccttgtagattcagtcgctaaaaccattgatgccggatgcaaaccgtacatg
gcccccgaaagaataaacccagagctcaatcagaagggatatagtgtgaagtctgacatt
tggagtctgggcatcacaatgattgagttggcgatccttcggtttccctatgactcttgg
ggaactcccttccaacagctcaaacaggtggtagaggagccctcaccacagctcccggga
gacaagttcaccgaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaacggccaacgtatccagagcttatgcaacatccatttttcaccctacacgaatccaaa
gcaacagacgtggcatcttttgtaaaattgattcttggagactaa

DBGET integrated database retrieval system