KEGG   Felis catus (domestic cat): 101089839Help
Entry
101089839         CDS       T02385                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04068  FoxO signaling pathway
fca04270  Vascular smooth muscle contraction
fca04650  Natural killer cell mediated cytotoxicity
fca04720  Long-term potentiation
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04928  Parathyroid hormone synthesis, secretion and action
fca05034  Alcoholism
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101089839 (ARAF)
   04012 ErbB signaling pathway
    101089839 (ARAF)
   04068 FoxO signaling pathway
    101089839 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101089839 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101089839 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101089839 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    101089839 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    101089839 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101089839 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    101089839 (ARAF)
   04720 Long-term potentiation
    101089839 (ARAF)
   04730 Long-term depression
    101089839 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089839 (ARAF)
   05205 Proteoglycans in cancer
    101089839 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101089839 (ARAF)
   05212 Pancreatic cancer
    101089839 (ARAF)
   05225 Hepatocellular carcinoma
    101089839 (ARAF)
   05226 Gastric cancer
    101089839 (ARAF)
   05214 Glioma
    101089839 (ARAF)
   05221 Acute myeloid leukemia
    101089839 (ARAF)
   05220 Chronic myeloid leukemia
    101089839 (ARAF)
   05218 Melanoma
    101089839 (ARAF)
   05211 Renal cell carcinoma
    101089839 (ARAF)
   05219 Bladder cancer
    101089839 (ARAF)
   05215 Prostate cancer
    101089839 (ARAF)
   05213 Endometrial cancer
    101089839 (ARAF)
   05224 Breast cancer
    101089839 (ARAF)
   05223 Non-small cell lung cancer
    101089839 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    101089839 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101089839 (ARAF)
   05160 Hepatitis C
    101089839 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101089839 (ARAF)
   01522 Endocrine resistance
    101089839 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101089839 (ARAF)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101089839 (ARAF)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101089839 (ARAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like Pkinase_fungal zf-RING-like APH TUG-UBL1 Kdo
Motif
Other DBs
NCBI-GeneID: 101089839
NCBI-ProteinID: XP_006943743
Ensembl: ENSFCAG00000025248
UniProt: M3X071
Position
X
AA seq 608 aa AA seqDB search
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIEGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQVYHSVQDLSGGSRQHEAPSNRPLNEPL
TPQGPSSRTQHRDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSSLLQLTAQSFS
TDAAGSRGGGDGAPRGSPSPSVPSGRKSPHSKSPSEQREQRERKSLADDKKKVKNLGYRD
SGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVL
RKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMD
YLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVI
RMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNC
PKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACL
LSAARLVP
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaacggggccgagccgtcccgggcagtgggcact
gtcaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctacgactctctagacaaggccctcaaggtacggggtcttaatcaggattgctgtgtg
gtctaccggctgattgaggggcgaaagacagtcactgcctgggacacagccattgccccc
ctggatggagaggagctcatcgtagaggtccttgaagatgtgccactgaccatgcacaat
tttgtacggaagacgttcttcagcctggcattctgtgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggctacaagttccaccagcactgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccgacaggtctaccacagtgtccaggat
ttgtccggaggctccagacagcacgaggctccctcgaaccgccccctgaatgagccgcta
acccctcagggtcccagctcccgcacccagcaccgcgaccctgagcactttcccttcccc
gcccctgccaacgccccactccagcgcatccgctccacatccactcccaacgtgcacatg
gtcagcaccacggcccccatggactccagcctcctccagctcactgcccagagtttcagc
accgatgctgctggtagtagaggcggtggcgacggagccccccgggggagccccagcccc
agcgtgccctcggggaggaagtccccacattccaaatccccgtcggagcagcgtgagcag
cgggagcggaagtccttggctgatgacaagaagaaagtgaagaatctggggtaccgggac
tcgggctattactgggaggtgccgcccagcgaggtgcagctgctgaagaggatcgggacg
ggctcgtttggcaccgtgtttcgcgggcggtggcatggagacgtggccgtgaaggtgctc
aaggtggctcaacccacagcggagcaggcgcaggccttcaagaacgagatgcaggtgctc
aggaagacacgtcatgtcaacatcttgctattcatgggcttcatgacccggccgggattt
gccatcatcacacagtggtgtgagggctccagcctgtaccaccacctacatgtggccgac
acacgcttcgacatggtccagctcatcgacgtggcccggcagactgcccagggcatggac
tacctccatgccaagaacattatccaccgagatctcaagtctaacaacatcttcctacac
gaggggctcacagtgaagatcggtgactttggcctggccacggtgaagacacggtggagc
ggggcccagcccttggaacagccctcgggctctgtgctatggatggcggctgaggtgatc
cgtatgcaggacccgaacccctacagcttccagtcggatgtctacgcctacggggttgtg
ctctatgagctcatgaccggctctctgccttacagccacattggcagccgtgaccagatt
atcttcatggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaactgc
cccaaggccatgcggcgcctgctgtctgactgcctcaagttccagcgagaggaacgtccc
ctcttcccccagatcctggccacgattgagctgctgcagcggtcactccccaagattgag
cggagtgcctccgaaccctccttgcaccgcacccaggctgatgagttgcctgcctgcctc
ctcagcgcggcccgccttgtgccttag

KEGG   Felis catus (domestic cat): 101092346Help
Entry
101092346         CDS       T02385                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X4
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04068  FoxO signaling pathway
fca04150  mTOR signaling pathway
fca04270  Vascular smooth muscle contraction
fca04510  Focal adhesion
fca04650  Natural killer cell mediated cytotoxicity
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca05034  Alcoholism
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101092346 (BRAF)
   04010 MAPK signaling pathway
    101092346 (BRAF)
   04012 ErbB signaling pathway
    101092346 (BRAF)
   04068 FoxO signaling pathway
    101092346 (BRAF)
   04024 cAMP signaling pathway
    101092346 (BRAF)
   04150 mTOR signaling pathway
    101092346 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092346 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101092346 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101092346 (BRAF)
   04062 Chemokine signaling pathway
    101092346 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101092346 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    101092346 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    101092346 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101092346 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    101092346 (BRAF)
   04720 Long-term potentiation
    101092346 (BRAF)
   04730 Long-term depression
    101092346 (BRAF)
   04722 Neurotrophin signaling pathway
    101092346 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092346 (BRAF)
   05205 Proteoglycans in cancer
    101092346 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101092346 (BRAF)
   05212 Pancreatic cancer
    101092346 (BRAF)
   05225 Hepatocellular carcinoma
    101092346 (BRAF)
   05226 Gastric cancer
    101092346 (BRAF)
   05214 Glioma
    101092346 (BRAF)
   05216 Thyroid cancer
    101092346 (BRAF)
   05221 Acute myeloid leukemia
    101092346 (BRAF)
   05220 Chronic myeloid leukemia
    101092346 (BRAF)
   05218 Melanoma
    101092346 (BRAF)
   05211 Renal cell carcinoma
    101092346 (BRAF)
   05219 Bladder cancer
    101092346 (BRAF)
   05215 Prostate cancer
    101092346 (BRAF)
   05213 Endometrial cancer
    101092346 (BRAF)
   05224 Breast cancer
    101092346 (BRAF)
   05223 Non-small cell lung cancer
    101092346 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    101092346 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101092346 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101092346 (BRAF)
   05160 Hepatitis C
    101092346 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101092346 (BRAF)
   01522 Endocrine resistance
    101092346 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101092346 (BRAF)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101092346 (BRAF)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101092346 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 101092346
NCBI-ProteinID: XP_006929486
Ensembl: ENSFCAG00000012847
UniProt: A0A2I2ULH6
Position
A2
AA seq 764 aa AA seqDB search
MAALSGGGGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEA
LLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSS
SSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKK
ALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFF
TLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQE
EASIAETALTSGSSPSAPPSDSTGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRS
SSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQ
RERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVK
MLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHI
IETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRD
QIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
IHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggtggcgcggagcagggccaggctctgttc
aacggggacatggagcccgaagccggcgccgcggcctcttcggctgcggaccctgccatt
cccgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaggcc
ctattggacaaatttggtggggagcataatccaccatcaatatatctagaggcctatgaa
gaatacaccagcaagctagatgccctccaacagagagaacaacagttattggaatccctg
gggaatggaactgatttttctgtttctagctctgcatcaacggacaccgttacatcttcc
tcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaaccccacagat
gtgtcacggagcaatcccaagtcaccacagaaacctatcgttagagtcttcctgcctaat
aaacagaggacagtggtacctgcaagatgtggagttacagtccgggacagtctaaagaaa
gctctgatgatgagaggtctaatccctgagtgctgtgctgtttacagaattcaggatgga
gagaagaaaccaattggctgggacactgatatctcctggctcaccggagaggaattgcat
gtagaagtgttggaaaatgttccacttacaactcacaactttgtacggaaaacgtttttc
accttagcattttgtgacttttgtcgaaagctgcttttccaaggttttcgctgtcaaacg
tgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattat
gaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacaggag
gaggcctccatagcagagactgccctaacgtctggatcgtccccttctgcccccccctcc
gattctactgggccccaaattctcaccagtccgtctccttcaaaatccattccaattcca
cagcctttccgaccagcagatgaagatcatcgaaatcaatttggacagcgagaccggtcc
tcatcagctccaaatgtgcatataaatacaatagaacctgtcaatattgatgacttgatt
agagaccaggggtttcgtagtgatggaggatcaaccacaggcttgtctgccaccccccct
gcctcattgccgggctctctcactaatgtaaaagcattacagaaatctccagggcctcag
cgggaaaggaaatcttcttcatcctcagaagataggaatcgaatgaaaacacttggtaga
agggattcaagtgatgattgggagattcctgatgggcagatcacagtgggacagagaatt
ggatccgggtcatttgggacagtctacaagggaaagtggcatggtgatgtggcagtgaaa
atgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagtagga
gtactcaggaaaactcggcatgtgaacatcctgctcttcatgggctattcaacaaagccc
cagctggctattgtcacccagtggtgtgagggctccagcttataccaccatctccacatc
atcgagaccaaattcgagatgatcaagctgatagatattgctcggcagactgcgcagggc
atggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatattttt
cttcacgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatctcga
tggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaa
gtaattcgaatgcaagataaaaacccatatagctttcagtcagatgtatatgcatttggg
attgttctatatgaattgatgactggacagttaccttattcaaacatcaacaacagggac
cagataatttttatggtgggacgaggatatctttctccagatctcagtaaggtacgaagt
aactgtccgaaagccatgaagagattgatggcagagtgcctaaaaaagaaaagagatgag
aggccactgtttccccaaattcttgcctctattgagctgctggcccgctcattgccaaaa
attcaccgcagtgcatcagaaccctccttgaatcgggctggcttccagacagaggatttt
agtctctatgcttgtgcttctccaaaaacacccatccaggcagggggatatggagaattt
gcagccttcaagtag

KEGG   Felis catus (domestic cat): 101096047Help
Entry
101096047         CDS       T02385                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X2
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04218  Cellular senescence
fca04270  Vascular smooth muscle contraction
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05034  Alcoholism
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
fca_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101096047 (RAF1)
   04015 Rap1 signaling pathway
    101096047 (RAF1)
   04010 MAPK signaling pathway
    101096047 (RAF1)
   04012 ErbB signaling pathway
    101096047 (RAF1)
   04370 VEGF signaling pathway
    101096047 (RAF1)
   04371 Apelin signaling pathway
    101096047 (RAF1)
   04630 Jak-STAT signaling pathway
    101096047 (RAF1)
   04068 FoxO signaling pathway
    101096047 (RAF1)
   04072 Phospholipase D signaling pathway
    101096047 (RAF1)
   04071 Sphingolipid signaling pathway
    101096047 (RAF1)
   04024 cAMP signaling pathway
    101096047 (RAF1)
   04022 cGMP-PKG signaling pathway
    101096047 (RAF1)
   04151 PI3K-Akt signaling pathway
    101096047 (RAF1)
   04150 mTOR signaling pathway
    101096047 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101096047 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    101096047 (RAF1)
   04218 Cellular senescence
    101096047 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101096047 (RAF1)
   04540 Gap junction
    101096047 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101096047 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101096047 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101096047 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    101096047 (RAF1)
   04660 T cell receptor signaling pathway
    101096047 (RAF1)
   04662 B cell receptor signaling pathway
    101096047 (RAF1)
   04664 Fc epsilon RI signaling pathway
    101096047 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    101096047 (RAF1)
   04062 Chemokine signaling pathway
    101096047 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101096047 (RAF1)
   04912 GnRH signaling pathway
    101096047 (RAF1)
   04915 Estrogen signaling pathway
    101096047 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    101096047 (RAF1)
   04917 Prolactin signaling pathway
    101096047 (RAF1)
   04921 Oxytocin signaling pathway
    101096047 (RAF1)
   04926 Relaxin signaling pathway
    101096047 (RAF1)
   04919 Thyroid hormone signaling pathway
    101096047 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    101096047 (RAF1)
   04916 Melanogenesis
    101096047 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101096047 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    101096047 (RAF1)
   04720 Long-term potentiation
    101096047 (RAF1)
   04730 Long-term depression
    101096047 (RAF1)
   04722 Neurotrophin signaling pathway
    101096047 (RAF1)
  09158 Development
   04360 Axon guidance
    101096047 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101096047 (RAF1)
   05206 MicroRNAs in cancer
    101096047 (RAF1)
   05205 Proteoglycans in cancer
    101096047 (RAF1)
   05230 Central carbon metabolism in cancer
    101096047 (RAF1)
   05231 Choline metabolism in cancer
    101096047 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101096047 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101096047 (RAF1)
   05212 Pancreatic cancer
    101096047 (RAF1)
   05225 Hepatocellular carcinoma
    101096047 (RAF1)
   05226 Gastric cancer
    101096047 (RAF1)
   05214 Glioma
    101096047 (RAF1)
   05221 Acute myeloid leukemia
    101096047 (RAF1)
   05220 Chronic myeloid leukemia
    101096047 (RAF1)
   05218 Melanoma
    101096047 (RAF1)
   05211 Renal cell carcinoma
    101096047 (RAF1)
   05219 Bladder cancer
    101096047 (RAF1)
   05215 Prostate cancer
    101096047 (RAF1)
   05213 Endometrial cancer
    101096047 (RAF1)
   05224 Breast cancer
    101096047 (RAF1)
   05223 Non-small cell lung cancer
    101096047 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    101096047 (RAF1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101096047 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101096047 (RAF1)
   05164 Influenza A
    101096047 (RAF1)
   05161 Hepatitis B
    101096047 (RAF1)
   05160 Hepatitis C
    101096047 (RAF1)
   05163 Human cytomegalovirus infection
    101096047 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101096047 (RAF1)
   05165 Human papillomavirus infection
    101096047 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101096047 (RAF1)
   01522 Endocrine resistance
    101096047 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101096047 (RAF1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101096047 (RAF1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101096047 (RAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like Pkinase_fungal zf-RING-like C1_2
Motif
Other DBs
NCBI-GeneID: 101096047
NCBI-ProteinID: XP_003982549
Ensembl: ENSFCAG00000026299
UniProt: M3XB73
Position
A2
AA seq 648 aa AA seqDB search
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQPFGFQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDATS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSPIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NSSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatacaaggggcctggaagacgatcagcaatggctttggattcaaagatgca
gtgtttgatggccccagctgcatctcccctacaatagttcagccatttggctttcagcgt
cgggcatcagatgatggcaaacttacggactcttctaagacaagcaacactatccgtgtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgagaaatggaatgagcttgcatgat
tgccttatgaaagcactcaaggtgaggggcctgcagccggagtgctgtgcagtgttcaga
cttctccatgaacataaaggtaaaaaagcgcgtttagattggaatactgatgccacctcg
ttgattggagaagaacttcaagtagatttcctggatcacgttcccctcacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgacatctgtcagaagttcctgcta
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttattgttcccaaattctcct
attggtgatagtggggtcccagcactgccttctttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgccttcacgttc
aactcttccagcccttcctctgaaggttccctctcccagaggcagaggtcaacatccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagccacagtgaatcagcctcaccttcagccttgtccagcagccctaacaatctg
agcccaacgggctggtcacagcccaaaacccctgtgccagcacagagagagagggcacca
ggatctgggacccaggagaaaaacaaaatcaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagcgaagtgatgctttccactcggattggatcaggctcattt
ggaacggtgtataagggcaagtggcatggagatgttgcagtgaaaattctaaaagttgtc
gaccccacgccagagcagttccaggccttcaggaatgaggtggctgtcctacgcaaaaca
cggcacgtgaacatcctgctcttcatgggctacatgacaaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctctacaaacacctgcatgtccaggagactaagttc
cagatgttccagttgattgacatcgcccgccagactgctcagggaatggactatttgcat
gcaaagaatatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagattttggtttggcaacagtaaagtcgcgctggagcggttctcag
caggtcgaacaacccactggctctgtcctgtggatggcccccgaggtgatccgaatgcag
gataataacccattcagcttccagtctgatgtctactcctacggcattgtgctctatgag
ctcatgacaggggagcttccttactcccacatcaataaccgcgaccagatcatcttcatg
gtgggccgaggatatgcctccccagacctcagtaagctatataagaactgccccaaagca
atgaagaggcttgtagctgactgtgtgaagaaggttaaggaagagaggcctctttttccc
cagatcctgtcttccatcgagcttctccaacactctctgccgaaaatcaaccggagtgct
tctgagccatccctgcaccgggcggcccacactgaggatatcaacgcctgcacgttgacc
acatcccctagactgcctgtcttctag

DBGET integrated database retrieval system