KEGG   Felis catus (domestic cat): 101089865Help
Entry
101089865         CDS       T02385                                 

Gene name
ARG1
Definition
(RefSeq) arginase-1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00220  Arginine biosynthesis
fca00330  Arginine and proline metabolism
fca01100  Metabolic pathways
fca01230  Biosynthesis of amino acids
fca05146  Amoebiasis
Module
fca_M00029  Urea cycle
fca_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101089865 (ARG1)
   00330 Arginine and proline metabolism
    101089865 (ARG1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101089865 (ARG1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101089865 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 101089865
NCBI-ProteinID: XP_003986598
Ensembl: ENSFCAG00000002068
UniProt: M3VXU3
Position
B2
AA seq 322 aa AA seqDB search
MSSKSKSIGIIGVPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQGCDVKDYGDLPFVDVPN
DPPFEIVKNPRSVGKANEQLAGVVAEVKKNGRTSLVLGGDHSMAIGSISGHARVHPDLCV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEEALSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVPGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVTVT
LACFGVAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaagtcaaaatccattgggatcatcggagtgcctttctcaaagggccagcca
cgaggaggcgtggaagaaggccctaccgtattgagaaaggctggcctgcttgagaaactt
aaagaacaagggtgtgatgtgaaagattacggggacctgccctttgttgacgtccctaat
gatcctccctttgaaattgtgaagaatccaaggtctgtgggaaaagcgaatgagcagctg
gctggtgtggtggcagaggtgaagaagaatggaaggaccagcctggtgctgggcggagac
cacagtatggcgattggaagcatctctggccatgccagggtccacccagatctctgcgtc
atttgggtggatgctcacactgatatcaacactccactgacaaccacaagtgggaacttg
cacggacaacctgtgtctttcctcctgaaggaactaaaaggaaagatccctgatgtacca
ggattctcgtgggtgactccctgcatatccgccaaagatattgtgtatattggcctgaga
gacgtggatcctggggaacactatattttgaaaactctgggtattaagtatttttcaatg
actgaagtggataaactgggcattggcaaggtgatggaagaagcactcagctacctacta
ggaagaaagaaaaggccaattcatttgagcttcgatgttgatggactggacccatccttc
acaccagctactggcacaccagtcccgggaggtctgacttacagagaaggtctctacatt
acagaagaaatttacaaaacagggctactctcaggattagatataatggaagtgaaccca
tctctggggaagacaccggaagaagtaactcgaacagtgaacacagcagtaacagtaacc
ttggcttgctttggagttgctcgggagggtaatcataagcctattgactaccttaaccca
cctaagtaa

KEGG   Felis catus (domestic cat): 101092944Help
Entry
101092944         CDS       T02385                                 

Gene name
ARG2
Definition
(RefSeq) arginase-2, mitochondrial isoform X1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00220  Arginine biosynthesis
fca00330  Arginine and proline metabolism
fca01100  Metabolic pathways
fca01230  Biosynthesis of amino acids
fca05146  Amoebiasis
Module
fca_M00029  Urea cycle
fca_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101092944 (ARG2)
   00330 Arginine and proline metabolism
    101092944 (ARG2)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101092944 (ARG2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101092944 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 101092944
NCBI-ProteinID: XP_003987800
Ensembl: ENSFCAG00000014088
UniProt: M3WK19
Position
B3
AA seq 354 aa AA seqDB search
MSLRSSLSRLLRTRVHSVLKKSVHSVAVIGAPFSQGQKRKGVERGPAAIREAGLMKRLSS
LGCRLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYITEEIHNTGLLSALDLVEVNPQ
LAASEEEAKATAGLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESESEERVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgagaagcagcctctcgcgtctcctccggacgcgagtgcattccgtcctgaag
aagtcggttcactcggtggctgtgatcggagccccgttctcacagggacagaaaagaaaa
ggagtggaacgtggtcctgctgccatccgagaagctggcttgatgaaaagactctccagt
ttaggctgccgcctgaaagattttggagatttgagttttactccagtccctaaagatgat
ctctacaacaacctgattgtgaatcctcgctcagtgggccttgccaaccaggaattggct
gaggtggttagtagagctgtgtcaggtggctacagctgtgtcacagtgggaggagatcac
agcctggcaattggtaccattagtggccacgcccgacattgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtaccacaactcccagga
ttttcttggatcaaaccttgtatctcttccccaagtatcgtgtatattggtctgagagat
gtggaccctcctgaacattttattttaaagaattatgatatccagtatttttccatgaga
gacatagatcgacttggtatccagaaggttatggaacagacatttgatctgctaattggc
aaaagacaaaggccaatccatctgagttttgatattgatgcatttgaccctacactggct
ccagccacaggaacccctgttgtaggaggactgacctatcgagaaggcatgtatattact
gaagaaatacacaatacaggattgctgtcagcactggatcttgttgaagtcaaccctcag
ctggctgcttcagaggaagaggccaaggctactgcaggcctggcagtggatgtgattgct
tccagttttggtcagacaagggagggagggcacattgtctatgaccaacttcctactccc
agttcaccagatgaatcagaaagtgaagaacgtgtgagaatttag

DBGET integrated database retrieval system