KEGG   Felis catus (domestic cat): 101089928Help
Entry
101089928         CDS       T02385                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00561  Glycerolipid metabolism
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04923  Regulation of lipolysis in adipocytes
Module
fca_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101089928 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101089928 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101089928 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    101089928 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101089928 (MGLL)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101089928 (MGLL)
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S33
   101089928 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Peptidase_S9 Abhydrolase_5 PGAP1 LIDHydrolase Thioesterase
Motif
Other DBs
NCBI-GeneID: 101089928
NCBI-ProteinID: XP_023105849
Ensembl: ENSFCAG00000026204
Position
A2
AA seq 369 aa AA seqDB search
MPPCDRRDEGTALICLALILHAVVVVECKSQDMMETGLGDPFRMPEESSPRQTPQSVPYQ
DLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHCGRYDELAQMLVGLELLVFAHDH
VGHGQSEGERMVVSDFHVFIRDVLQHVDVMQKDYPGLPVFLLGHSMGGAITILTAAERPG
LFSGMVLISPLVLASPESATTFKDYPKSVVKMATRVAFSSISTSYWVFAAKILNLVLPNM
SLGPIDSSMLSRNKTEVDIYNADPLICRAGLKVCFGNQLLNAVTRVERALPKLTLPFLLL
QGSADRLCDSKGAYLVMESTKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRT
AAAGKRSPL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctgtgaccgccgagatgagggaacagcccttatttgcctggctctgattctc
catgctgtcgtggttgtggaatgcaaaagccaggacatgatggaaacaggacttggagat
cctttcagaatgccggaggaaagttctcccaggcagaccccacagagcgttccataccag
gacctgcctcacctggtcaatgccgatggacagtacctcttctgcaggtactggaaacct
acgggcacacccaaggccctcatctttgtgtcccatggagccggggagcactgtggccgc
tatgacgagctggctcagatgctggtggggctcgagctgctggtgttcgcccacgaccat
gttggccatggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcatc
agggatgtgctacagcacgtggatgtcatgcagaaagactacccggggcttcctgtgttc
ctgctgggccactccatgggaggtgccatcaccatccttacggccgcagagagaccgggc
ctcttctccggcatggtcctcatttcgcctttggttcttgccagtcctgagtctgcaaca
actttcaaggattatccgaagagcgtggtcaaaatggcgacgagagtggcattctcttca
atttcaacttcttattgggtctttgctgcgaaaattctcaaccttgtcctgccaaacatg
tccctgggcccaatcgactccagcatgctctctcggaataagacggaggtcgacatttat
aatgcggaccccctcatctgccgggcgggactgaaggtgtgcttcggcaaccagctgctc
aatgccgtcacgcgggtggagcgggccctccccaagctgaccttgcccttcctgctgctc
cagggctctgccgaccgcctttgtgacagcaaaggggcctacctggtcatggagtccacc
aagagccaggacaagacactcaagatttacgaaggtgcctaccacgttctccacaaagag
cttccagaagtaaccaactccgtcttccacgaaataaacatgtgggtctcccaaaggaca
gcagccgcgggaaagcggtccccgctctga

DBGET integrated database retrieval system