KEGG   Felis catus (domestic cat): 101089929Help
Entry
101089929         CDS       T02385                                 

Gene name
CPA1
Definition
(RefSeq) carboxypeptidase A1 isoform X1
  KO
K08779  carboxypeptidase A1 [EC:3.4.17.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04972  Pancreatic secretion
fca04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    101089929 (CPA1)
   04974 Protein digestion and absorption
    101089929 (CPA1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     101089929 (CPA1)
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   101089929 (CPA1)
Chaperones and folding catalysts [BR:fca03110]
 Intramolecular chaperones
  Other peptidases
   101089929 (CPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 Propep_M14
Motif
Other DBs
NCBI-GeneID: 101089929
NCBI-ProteinID: XP_003983104
Ensembl: ENSFCAG00000014234
UniProt: M3WKB7
Position
A2
AA seq 365 aa AA seqDB search
MRGLLIWSVLLGAVLGKEDFVGHQVLRISAADEAQVQKVKELEDLEHLQLDFWRGPGQPG
SPIDVRVPFPSIQAVKAFLEAHGLGYTIMIEDVQSLLDEEQEQMFAFQARSRSTDTFNYA
TYHTLEEIYGFMDLLVAEHPQLVSKLQIGNTYEGRPIYVLKFSTGGNNRPAIWIDTGIHS
REWVTQASGVWFAKKITQDYGQDFTLTAILDSMDIFLEIVTNPDGFAFTHSKNRMWRKTR
SLTPGSSCVGVDPNRNWDAGFGMPGASSNPLHGHLPGQVCKFRSGGQVHRGLCEEPREHQ
GLRLHPQLLPAPPVSLRLQGRASPQPGRAGSAGQVCCDGPGLSVWDQVQVRQHHQNDLPS
QRKHH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagggggctgctgatttggagtgtgctgctaggggctgtccttggcaaagaggacttt
gtggggcaccaggtgctccgaatctctgctgccgatgaagcccaggtccagaaggtgaag
gagctggaggacctcgagcacctgcagctggacttctggcggggccctggccagcccggc
tctcccatcgacgtccgagtgcccttccccagcatccaggctgtcaaggccttcctggag
gcccacggcctcgggtacacgatcatgattgaggacgtgcagtcgttgctggacgaggag
caggagcagatgttcgccttccaggcccggtcccgctccaccgacaccttcaactacgcc
acctaccacaccctggaggagatctacggcttcatggatctgctggtggccgagcaccca
cagcttgtgagcaagctccagatcggcaacacctacgaggggcgtcccatctatgtgctg
aagttcagcaccgggggcaacaaccgtcccgccatctggatcgacacggggatccattcc
cgggagtgggttacccaggccagcggggtctggtttgccaagaagatcacacaagactat
ggccaggacttcactctcactgccattcttgattccatggacatcttcctggagattgtc
actaaccctgatggttttgccttcacccacagcaagaatcgcatgtggcgcaagactcga
tccctcacaccgggctcctcctgtgttggggtggaccccaaccggaactgggacgctggc
tttgggatgcccggagccagcagcaaccccctgcacggacacttaccggggcaagtttgc
aaattccgaagtggaggtcaagtccatcgtggactttgtgaagagccacgggaacatcaa
ggccttcgtctccatccacagctactcccagctcctcctgtatccctacggctacaaggc
agagccagcccccaaccgggacgagctggatcagctggccaagtctgctgtgacggccct
ggcctctctgtatgggaccaagttcaagtacggcagcatcatcaaaacgatttaccaagc
cagcggaagcaccattga

DBGET integrated database retrieval system