KEGG   Felis catus (domestic cat): 101090005Help
Entry
101090005         CDS       T02385                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04062  Chemokine signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101090005 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101090005 (PLCB4)
   04310 Wnt signaling pathway
    101090005 (PLCB4)
   04371 Apelin signaling pathway
    101090005 (PLCB4)
   04020 Calcium signaling pathway
    101090005 (PLCB4)
   04070 Phosphatidylinositol signaling system
    101090005 (PLCB4)
   04072 Phospholipase D signaling pathway
    101090005 (PLCB4)
   04071 Sphingolipid signaling pathway
    101090005 (PLCB4)
   04022 cGMP-PKG signaling pathway
    101090005 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101090005 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101090005 (PLCB4)
   04621 NOD-like receptor signaling pathway
    101090005 (PLCB4)
   04062 Chemokine signaling pathway
    101090005 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    101090005 (PLCB4)
   04922 Glucagon signaling pathway
    101090005 (PLCB4)
   04912 GnRH signaling pathway
    101090005 (PLCB4)
   04915 Estrogen signaling pathway
    101090005 (PLCB4)
   04921 Oxytocin signaling pathway
    101090005 (PLCB4)
   04926 Relaxin signaling pathway
    101090005 (PLCB4)
   04918 Thyroid hormone synthesis
    101090005 (PLCB4)
   04919 Thyroid hormone signaling pathway
    101090005 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    101090005 (PLCB4)
   04916 Melanogenesis
    101090005 (PLCB4)
   04924 Renin secretion
    101090005 (PLCB4)
   04925 Aldosterone synthesis and secretion
    101090005 (PLCB4)
   04927 Cortisol synthesis and secretion
    101090005 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101090005 (PLCB4)
   04270 Vascular smooth muscle contraction
    101090005 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    101090005 (PLCB4)
   04971 Gastric acid secretion
    101090005 (PLCB4)
   04972 Pancreatic secretion
    101090005 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101090005 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101090005 (PLCB4)
   04725 Cholinergic synapse
    101090005 (PLCB4)
   04728 Dopaminergic synapse
    101090005 (PLCB4)
   04726 Serotonergic synapse
    101090005 (PLCB4)
   04720 Long-term potentiation
    101090005 (PLCB4)
   04730 Long-term depression
    101090005 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    101090005 (PLCB4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101090005 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101090005 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090005 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090005 (PLCB4)
   05016 Huntington disease
    101090005 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101090005 (PLCB4)
   04934 Cushing syndrome
    101090005 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101090005 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101090005 (PLCB4)
   05142 Chagas disease (American trypanosomiasis)
    101090005 (PLCB4)
   05143 African trypanosomiasis
    101090005 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101090005 (PLCB4)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101090005 (PLCB4)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101090005 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101090005 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 101090005
NCBI-ProteinID: XP_019682382
Ensembl: ENSFCAG00000005949
Position
A3
AA seq 1206 aa AA seqDB search
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVNILEDDNEEEIESADQEEEAHPEYKFGSELSADDLGHKEAVANSVKKASD
DLEHEINKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNRLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAALGSGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEVGSRDGPQTSNSSV
KLQNAN
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcaaaaggaagttccttcctttttgcaagaagga
gccgtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgaatttggcttctttctgacctggagaagtgaaggcaaggaaggacaagttcta
gaatgctccctcatcaacagtattcgattgggagccaccccaaaggatcccaaaatcctg
gctgctcttgaagctgttggaaagtcagagaatgatctggaagggcgaatagtttgtgtc
tgcagtggcacagatctggtgaacatcagtttcacatacatggtggctgaaaatccggaa
gtaactaagcaatgggtagaaggactgagatcaatcatacacaacttcagggccaacaat
gtcagtccaatgacctgcctcaaaaaacactggatgaaattggcgtttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacctttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaatcgag
cctgcagcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcgaaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcagcgagaccctcgactgaatgaaattttgttc
ccattttatgatgctaaaagggcaatgcagatcatcgagatgtatgagcctgatgaagat
ttgaagaaaaaaggcctcatatcaagcgatgggttttgcagatatctgatgtcagatgaa
aatgcccctgtcttcctggatcgtttagaactttaccaagaaatggaccatcctctggcc
cactacttcatcagttcttcccataacacctatctcactggccgacagtttggtggaaag
tcttccgtagaaatgtacagacaggttctcctggctggttgcaggtgtgttgaacttgac
tgttgggatggaaaaggtgaagaccaggaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgttattcaagccatcaaggaaactgcgtttgtcacatcc
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccactcgaaccaggcaggcccttaccatcccccaatgacctcaaaagaaaaatactcatc
aaaaataaacggctgaaacctgaggtcgaaaaaaaacagcttgaagctttgaaaagcatg
atggaagctggagaatctgctgccccggttaacatcttagaggatgataatgaagaggaa
atagagagtgctgaccaagaggaggaagctcaccctgaatacaaatttggaagtgaactt
tctgctgatgacttgggtcacaaggaggctgttgcaaatagtgtcaagaaggcttcagat
gaccttgaacatgaaatcaacaaaaagggcctggttactgtagaagatgaacaggcatgg
atggcatcttataaatatgtaggtgctaccactaatatccatccatatttgtctacaatg
atcaactatgcacagcctgtaaaatttcaaggtttccatgtggctgaagagcgcaatatt
cattataacatgtcttcttttaatgagtccgttggtctaggctacttgaagacacacgcg
attgaatttgtgaattacaacaaacggcaaatgagccgcatttaccccaagggaggccgg
gtcgattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttcg
ctcaactatcagaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcatgcggctaccttctcaaaccagatttcatgagacggcccgatcgaacatttgat
cccttctctgaaactcctgtcgacggggttattgcagccacttgctcagtgcaggtcata
tcaggtcagtttttatcagataagaaaattggtacatatgtagaagtggatatgtatggt
ttacccactgacaccatacgtaaggaattccgaactcgcatggtgatgaacaatggactc
aatccagtttacaatgaagaatcatttgtgtttcggaaggtgatcctccctgacctggca
gtcttgagaatagctgtgtatgacgacaacaataggctgataggccagaggattcttccg
ctggatggcctccaagcaggttatcgacacatttctcttcgaaatgagggaaataaacca
ttatcactgccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtggatgctttatcagatccaaagaaatttctttccattacggaaaagaga
gcagaccaaatgagagctatgggcattgaaactagtgacatagcagatgtgcccagtgat
acttctaagaatgacaagaaaggaaaggccaacactgccaaagcaaacgtgaccccgcag
agcagctctgagctcagaccaaccaccacagcggccctggggtctggagtggaagccaag
aaaggtatcgaacttatccctcaagtgaggatagaagatttaaagcagatgaaggcttac
ttgaagcatttaaagaaacaacagaaggagctaaattctttaaagaagaaacatgctaag
gagcacagcaccatgcagaagctgcattgcacacaagttgacaaaattgtggcacagtat
gacaaagagaagtcgacgcatgagaaaatcctagagaaggcaatgaagaagaagggggga
agtaattgtctcgaaatgaaaaaagaaacagaaattaaaattcagacactgacatcagat
cacaaatctaaggtcaaagagatagtggcccagcacacaaaggagtggtcagaaatgatt
aacacccacagtgctgaggagcaagaaatccgggacctgcacctcagccagcagtgtgag
ctcctgagaaagctactgatcagcgcccacgagcagcaaacccagcagctaaaactgtcc
catgacagggaaagcaaggaaatgcgagcacaccaggctaagatttctatggaaaatagc
aaagccatcagccaagataaatctatcaagaataaagcagagcgggaaaggagagtcagg
gagttaaatagcagcaacaccaaaaagtttctggaagaaagaaagagactcgccatgaaa
cagtccaaagaaatggatcagttgaaaaaagtccagcttgaacacctggagttcctagag
aaacagaatgagcagctattgaaatcctgccatgcagtgtcccaaacgcaaggcgaagga
gatgcagcagatggtgaagttggaagccgagatggaccgcagaccagcaacagtagtgtg
aaactccagaacgcaaactga

KEGG   Felis catus (domestic cat): 101090942Help
Entry
101090942         CDS       T02385                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04062  Chemokine signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101090942 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101090942 (PLCB2)
   04310 Wnt signaling pathway
    101090942 (PLCB2)
   04371 Apelin signaling pathway
    101090942 (PLCB2)
   04020 Calcium signaling pathway
    101090942 (PLCB2)
   04070 Phosphatidylinositol signaling system
    101090942 (PLCB2)
   04072 Phospholipase D signaling pathway
    101090942 (PLCB2)
   04071 Sphingolipid signaling pathway
    101090942 (PLCB2)
   04022 cGMP-PKG signaling pathway
    101090942 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101090942 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101090942 (PLCB2)
   04621 NOD-like receptor signaling pathway
    101090942 (PLCB2)
   04062 Chemokine signaling pathway
    101090942 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    101090942 (PLCB2)
   04922 Glucagon signaling pathway
    101090942 (PLCB2)
   04912 GnRH signaling pathway
    101090942 (PLCB2)
   04915 Estrogen signaling pathway
    101090942 (PLCB2)
   04921 Oxytocin signaling pathway
    101090942 (PLCB2)
   04926 Relaxin signaling pathway
    101090942 (PLCB2)
   04918 Thyroid hormone synthesis
    101090942 (PLCB2)
   04919 Thyroid hormone signaling pathway
    101090942 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    101090942 (PLCB2)
   04916 Melanogenesis
    101090942 (PLCB2)
   04924 Renin secretion
    101090942 (PLCB2)
   04925 Aldosterone synthesis and secretion
    101090942 (PLCB2)
   04927 Cortisol synthesis and secretion
    101090942 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101090942 (PLCB2)
   04270 Vascular smooth muscle contraction
    101090942 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    101090942 (PLCB2)
   04971 Gastric acid secretion
    101090942 (PLCB2)
   04972 Pancreatic secretion
    101090942 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101090942 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101090942 (PLCB2)
   04725 Cholinergic synapse
    101090942 (PLCB2)
   04728 Dopaminergic synapse
    101090942 (PLCB2)
   04726 Serotonergic synapse
    101090942 (PLCB2)
   04720 Long-term potentiation
    101090942 (PLCB2)
   04730 Long-term depression
    101090942 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    101090942 (PLCB2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101090942 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101090942 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090942 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090942 (PLCB2)
   05016 Huntington disease
    101090942 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101090942 (PLCB2)
   04934 Cushing syndrome
    101090942 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101090942 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101090942 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    101090942 (PLCB2)
   05143 African trypanosomiasis
    101090942 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101090942 (PLCB2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101090942 (PLCB2)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101090942 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101090942 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 AAA_13 Lectin_N Gp58
Motif
Other DBs
NCBI-GeneID: 101090942
NCBI-ProteinID: XP_023111263
Ensembl: ENSFCAG00000001138
Position
B3
AA seq 1195 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEIEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPENNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGQNWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALSSCHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVRGLIDKYEPSAINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLYQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGRPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPASPSKEPGGE
AEGDCPPSASVGEGTAWAGEEGAEPEEEEVEEEEESGSLNEEEIKKMQSDEGTAGLEVTA
YEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMSR
IYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMR
RPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKL
SPSANSINPVWKEEPFVFEKILMPELASLRVAVMEEGNRFLGHRIIPINALNSGYHHLCL
HSESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKFFSAHDKKSVKLKEAIGGLPE
KPFPPGSPVAGHVNGALAPLSNGSAAHAVALAAAGARARAREDAVKEAAEPRTASLEELR
ELKGVVKLQRRHEKELRDLERRGARRWEELLQRGAAQLTELGQPGPGGCGGRSLGASKGS
RKKRTPLCEEAAGAAPSEGREGPEGADARARELKDRLELELLQQGEERYECILKRKEQHV
AEQIAKMMELAREKQAAELKTLKETLETDTKEMKKKLEAKRIERIQAMVKVTSDKMAQER
LKREINNSHIQEVVQAIKQMTENLEKHQEKLEEKQAACLEQIREMEKQFQQEALAEYEAK
MKGLEAEVKESVRTCLRDCFPSEAKDKPERSFGAFKELCEQDPLTAKADAQESRL
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcttatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaaccacaatagcctccccggttatcctccgcgtg
gatcccaagggctactacttatattggacatatcagagtaaggagatagagtttctggat
atcaccagcatcagggatactcgctttgggaagtttgccaagatacccaagagccagaag
ctccgggatgtcttcaacatggactttcctgagaacaacttcctgctaaagacgctcact
gtggtgtctggcccggacatggtggacctcaccttccacaactttgtctcctacaaggag
aacgtaggccagaactgggctgaagatgtcctggctctggtcaagcacccgctgacagcc
aatgcctctcgcagcaccttcctggacaaaatcctggtaaagctcaagatgcagctcaat
cccgaagggaagattcctgtgaagaattttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgccctcagctcctgccacctccccaaaggcaagaatgatgccatcaatcct
gaggacttcccagaatccgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcctaccacgccaaggccaagccctacatgaccaaggaacac
ctgaccaaattcatcaaccagaaacagagggactcccgcctcaactctttgctgtttccg
cccgcccggcctgaccaagtgcggggcctcatcgacaagtacgagcccagcgcaatcaac
gtgcagaggggccagctgtcacctgagggcatggtgtggtttctctgtgggccagagaac
agtgtgctggcccaggacaagctgctactctaccaagacatgacacagccactcaaccat
tacttcatcaactcctcacacaacacctacctgacagctggccagttctctggcctttcc
tcggcagagatgtaccgccaggtgctgctggctggctgtcgctgcgtggagctggactgc
tggaagggcaggccccctgacgaggagcccatcatcacccacggctttaccatgaccaca
gacatctatttcaaggaagcaattgaagccattgcagaaagtgcttttaagacctccccc
tatcctgtcatcctgtcatttgaaaaccatgtggactcaccccgccaacaggccaagatg
gctgagtattgccggacgatgtttggggacatgctactcacagagcccctggaaaagttc
ccactgaaaccaggcatccccctgcccagccccgaggatctccgaggcaagatcctcatc
aagaacaaaaagaaccagttttctggcccagcatcccccagcaaggagccgggtggggag
gcggagggcgactgcccacccagtgcctctgtgggtgagggcacagcgtgggctggtgaa
gaaggagcagagccggaggaggaagaggtggaagaggaggaggagtcgggaagcctgaat
gaggaagagatcaagaagatgcagtcggacgagggcacagcgggcctggaggtgacggct
tatgaggagatgtccagcctagtgaattacattcaacccaccaagttcatctcctttgag
ttctctgcccagaagaaccgaagttatgtcatctcctccttcacagagctcaaggcttac
gacctgctctccaaggcctcagtgcagtttgtggactacaacaagcgccagatgagccgc
atttaccctaagggcacccgcatggactcctccaactacatgccccagatgttctggaat
gctggttgccagatggttgccctcaacttccagacgatggacctgcccatgcagcagaac
atggcgctgtttgagttcaatgggcagagtggctacctcctcaagcatgagttcatgcgc
cggccagacaagcagttcaaccccttctcagtggaccgcatcgatgtggtggtagccacc
accctctccattacggtgatctctgggcagttcctgtcagaacgcagtgtgcgcacctat
gtcgaagtggagctgtttggccttcctggggaccccaagaggcgctatcgcaccaagctg
tcacccagtgccaactctatcaatcctgtctggaaggaggagccctttgtctttgagaag
atcttgatgcctgagctggcctccctcagggtggctgtaatggaggaaggcaacagattt
cttggacaccgcatcatccccattaatgccctgaattctggctaccaccatctgtgcctg
cacagcgagagcaacatgccccttaccatgcctgcgctttttgtcttcctggagatgaag
gactacgtacctgacacctgggcagatctcaccgtggctcttgccaatcccatcaagttc
ttcagtgcccacgataagaagtctgtgaagctcaaggaagccataggaggtctgcctgag
aaacccttcccacccgggagtccggtcgccggccacgtcaatggggcactggccccactg
agcaacgggtctgcagcccacgctgtggctcttgcagcagccggggccagggccagggcc
agggaggacgccgtgaaagaagctgcggagccgcggacggccagcctggaggagctgcgg
gagctgaagggcgtcgtgaagctgcagcggcggcacgagaaggagctgcgggacctggag
cggcgcggcgcgcggcgctgggaggagctgctgcagaggggcgcggcgcagctgaccgag
ctggggcagccgggcccggggggctgtgggggccgcagtctcggcgcgagcaagggttcc
cgcaagaagaggaccccgctctgcgaggaggccgccggggccgcgccgagcgagggccgc
gagggccccgagggcgcggacgcgcgcgcgcgggagctgaaggaccgcctggagctggag
ctgctgcagcagggcgaggagcggtacgagtgcatcctgaagcgcaaggagcagcacgtg
gccgagcaaatcgccaagatgatggagctggccagagagaagcaggctgcggagctgaag
accctcaaggagaccttggagactgataccaaagagatgaagaagaagctggaggccaag
aggatagagcggatccaggccatggtcaaagtcacctcggacaagatggctcaagaaagg
ctgaagagagagattaacaactctcacattcaggaggtggtgcaagccatcaagcagatg
acagagaacctggagaagcaccaggagaagctggaggagaagcaggcagcttgcctggag
cagatccgggagatggaaaagcagttccagcaggaggcactggcagagtacgaggccaag
atgaagggcttggaggccgaggtgaaggagtcagtgaggacctgcctcagggactgcttc
ccctctgaggccaaggacaagcctgagaggtcctttggggccttcaaggagctgtgtgag
caggacccactcacagcaaaggcagatgcccaggagagtcgcctctga

KEGG   Felis catus (domestic cat): 101092262Help
Entry
101092262         CDS       T02385                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04062  Chemokine signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101092262 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101092262 (PLCB1)
   04310 Wnt signaling pathway
    101092262 (PLCB1)
   04371 Apelin signaling pathway
    101092262 (PLCB1)
   04020 Calcium signaling pathway
    101092262 (PLCB1)
   04070 Phosphatidylinositol signaling system
    101092262 (PLCB1)
   04072 Phospholipase D signaling pathway
    101092262 (PLCB1)
   04071 Sphingolipid signaling pathway
    101092262 (PLCB1)
   04022 cGMP-PKG signaling pathway
    101092262 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101092262 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101092262 (PLCB1)
   04621 NOD-like receptor signaling pathway
    101092262 (PLCB1)
   04062 Chemokine signaling pathway
    101092262 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    101092262 (PLCB1)
   04922 Glucagon signaling pathway
    101092262 (PLCB1)
   04912 GnRH signaling pathway
    101092262 (PLCB1)
   04915 Estrogen signaling pathway
    101092262 (PLCB1)
   04921 Oxytocin signaling pathway
    101092262 (PLCB1)
   04926 Relaxin signaling pathway
    101092262 (PLCB1)
   04918 Thyroid hormone synthesis
    101092262 (PLCB1)
   04919 Thyroid hormone signaling pathway
    101092262 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    101092262 (PLCB1)
   04916 Melanogenesis
    101092262 (PLCB1)
   04924 Renin secretion
    101092262 (PLCB1)
   04925 Aldosterone synthesis and secretion
    101092262 (PLCB1)
   04927 Cortisol synthesis and secretion
    101092262 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101092262 (PLCB1)
   04270 Vascular smooth muscle contraction
    101092262 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    101092262 (PLCB1)
   04971 Gastric acid secretion
    101092262 (PLCB1)
   04972 Pancreatic secretion
    101092262 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101092262 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101092262 (PLCB1)
   04725 Cholinergic synapse
    101092262 (PLCB1)
   04728 Dopaminergic synapse
    101092262 (PLCB1)
   04726 Serotonergic synapse
    101092262 (PLCB1)
   04720 Long-term potentiation
    101092262 (PLCB1)
   04730 Long-term depression
    101092262 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    101092262 (PLCB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101092262 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101092262 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092262 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101092262 (PLCB1)
   05016 Huntington disease
    101092262 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101092262 (PLCB1)
   04934 Cushing syndrome
    101092262 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101092262 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101092262 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    101092262 (PLCB1)
   05143 African trypanosomiasis
    101092262 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092262 (PLCB1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101092262 (PLCB1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101092262 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101092262 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 101092262
NCBI-ProteinID: XP_023107218
Ensembl: ENSFCAG00000014951
Position
A3
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNDSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFETSKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKPFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQMDLEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPSLASDPGKLNHRPPSS
EELEGDNPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcacgctttgcaactcaagccggtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactccactattgtcactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaataaggag
acggagctgttagatctcagccttgtcaaggatgccagatgtgggaaacatgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcggacgcttggagcat
cgcatgataacggtggtgtacgggcctgacttagttaacatctcccatttgaatctcgtg
gctttccaagaggaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaatatgtccagagacgcatttctggaaaaagcctatacgaagcttaag
ctgcaagtcactccagaagggcgcattcctctcaaaaacatataccgcttgttctcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttctgaatttggtgccaaaagcaaaccatacctt
acagttgatcagatgatggattttatcaacctgaagcagcgagatcctcggctaaatgaa
atactttacccacctttaaagcaagagcaagtccaagtactgattgagaagtatgagccc
aacgatagccttgccaaaaaaggacagatatcagtggatggctttatgcgctatctgagt
ggagaagaaaatggagtcgtttcgcctgagaaactggatttgaatgaagatatgtctcag
cccctttctcactatttcatcaattcctcacacaacacctacctcacagctggccagctg
gctggaaattcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagttggactgctggaaaggacggactgcagaagaggaaccagtcatcacccatgggttc
accatgacaactgaaatatccttcaaggaagtgatagaagcaattgctgagtgtgcattt
aagacgtcaccttttccaattctgctttcatttgagaaccacgtagattccccaaagcag
caagccaagatggcagagtattgccgactgatctttggagatgctcttctcatggaacca
ctggaaaaatacccactggaatctggagttcctcttccaagccctatggatttaatgtac
aaaattttggtgaaaaataagaagaaatcgcataagtcatcagaaggaagtggcaaaaag
aagctctcagaacaagcctccaacacgtacagtgactcctccagcgtgtttgagccctca
tctccaggagccggggaagctgatactgagagtgacgacgatgacgatgatgacgactgt
aaaaaatcttcaatggatgagggtactgctggcagtgaggccatggccacagaagagatg
tctaacctggtgaactatattcagccagtcaagtttgagtcctttgaaacttcaaaaaaa
agaaatagaagttttgaaatgtcttccttcgtggaaaccaaaggactcgagcaactgaca
aagtctccagtggaatttgtagaatataacaaaatgcagctcagcaggatatatccaaaa
ggaacccgtgtggattcatccaactacatgcctcagctcttctggaatgctggttgccaa
atggttgcacttaattttcaaactgtggacctggctatgcaaataaatatggggatgtat
gaatacaatgggaaaagtggctacagattaaagccagagttcatgaggagacccgacaag
cactttgatccattcaccgaaggcatcgtagatgggatagtggccaacactttatctgtg
aagattatttcaggtcagtttctttctgataagaaagttgggacctatgtggaagtggat
atgtttggtttgcctgtggacacaaggaggaaggcatttaagaccaaaacatcacaagga
aatgctgtaaatcctgtctgggaagaagagcccattgtgttcaaaaaggtggttcttcct
tctctggcctgtttgaggatagcagtttatgaagaaggaggtaaatttatcggtcaccgg
atcttgcctgtacaggcaattcggccaggctatcactacatctgtctgcggaatgagagg
aaccagcctctgatgctcccagctgtctttgtctacatagaggtgaaagactatgtccca
gatacatatgcagatgtgattgaagctttgtcaaatccaatacgatatgtgaatctgatg
gagcagagagcaaagcaactggctgctctgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggggaaacaccatcagaagctccaagtgaagccaggacaactccagca
gaaaacggagtgaatcacactacatccctggcacccaaaccaccctcccaggctccccac
agccaaccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gttttaacagaagtggaagcacagactatcgaagagctaaagcaacagaaaccgtttgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggtgaaaagacaccacaagaaa
accactgaccttatcaaagaacacactacaaaatataatgaaattcagaatgactacttg
agaaggagggcagctttggaaaagacagccaaaaaggatagtaagaaaaaatcagaaccc
agcagtcctgaccatggttcatcaacaattgagcaagatcttgctgccctagatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcga
caagaacagtattacagtgagaaataccagaagcgagaacatattaaactgcttattcag
aaattgacggatgttgccgaagaatgtcagaacaatcagctgaagaagctcaaagaaatc
tgtgagaaggagaagaaggaattaaagaagaaaatggataaaaaaaggcaggagaagatc
acagaagctaaatccaaagacaaaagtcaaatggaagaggaaaagacagagatgatccgg
tcatacatccaggaggtggtacagtacatcaagaggttagaagaggcacaaagtaaacgg
caagaaaaacttgtagagaaacacaaggagatccgtcagcagatcctggatgaaaagccc
aagctgcagatggatctggagcaagagtaccaagacaagttcaaaagactgcccctggag
atcttggagttcgtgcaggaagccatgaaagggaagatcagtgaagacagcaatcacagt
tctgcccctccctccctggcctcagaccctggaaaactgaaccacaggcctccttccagt
gaggagctagaaggggacaacccaggaaaagagtttgatactcctctgtga

KEGG   Felis catus (domestic cat): 101092961Help
Entry
101092961         CDS       T02385                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04062  Chemokine signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
fca05016  Huntington disease
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101092961 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101092961 (PLCB3)
   04310 Wnt signaling pathway
    101092961 (PLCB3)
   04371 Apelin signaling pathway
    101092961 (PLCB3)
   04020 Calcium signaling pathway
    101092961 (PLCB3)
   04070 Phosphatidylinositol signaling system
    101092961 (PLCB3)
   04072 Phospholipase D signaling pathway
    101092961 (PLCB3)
   04071 Sphingolipid signaling pathway
    101092961 (PLCB3)
   04022 cGMP-PKG signaling pathway
    101092961 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101092961 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101092961 (PLCB3)
   04621 NOD-like receptor signaling pathway
    101092961 (PLCB3)
   04062 Chemokine signaling pathway
    101092961 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    101092961 (PLCB3)
   04922 Glucagon signaling pathway
    101092961 (PLCB3)
   04912 GnRH signaling pathway
    101092961 (PLCB3)
   04915 Estrogen signaling pathway
    101092961 (PLCB3)
   04921 Oxytocin signaling pathway
    101092961 (PLCB3)
   04926 Relaxin signaling pathway
    101092961 (PLCB3)
   04918 Thyroid hormone synthesis
    101092961 (PLCB3)
   04919 Thyroid hormone signaling pathway
    101092961 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    101092961 (PLCB3)
   04916 Melanogenesis
    101092961 (PLCB3)
   04924 Renin secretion
    101092961 (PLCB3)
   04925 Aldosterone synthesis and secretion
    101092961 (PLCB3)
   04927 Cortisol synthesis and secretion
    101092961 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101092961 (PLCB3)
   04270 Vascular smooth muscle contraction
    101092961 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    101092961 (PLCB3)
   04971 Gastric acid secretion
    101092961 (PLCB3)
   04972 Pancreatic secretion
    101092961 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101092961 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101092961 (PLCB3)
   04725 Cholinergic synapse
    101092961 (PLCB3)
   04728 Dopaminergic synapse
    101092961 (PLCB3)
   04726 Serotonergic synapse
    101092961 (PLCB3)
   04720 Long-term potentiation
    101092961 (PLCB3)
   04730 Long-term depression
    101092961 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    101092961 (PLCB3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101092961 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101092961 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092961 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101092961 (PLCB3)
   05016 Huntington disease
    101092961 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101092961 (PLCB3)
   04934 Cushing syndrome
    101092961 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101092961 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101092961 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    101092961 (PLCB3)
   05143 African trypanosomiasis
    101092961 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092961 (PLCB3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101092961 (PLCB3)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101092961 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101092961 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Motif
Other DBs
NCBI-GeneID: 101092961
NCBI-ProteinID: XP_023095762
Ensembl: ENSFCAG00000000507
Position
D1
AA seq 1249 aa AA seqDB search
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWTEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVPNS
SIRKRPLEQSSSALSESSATTEPSSPQLGSPSSDSCLGLSNGEELGLEKPSLEPRKSLGE
EGLQRGPDALGSADREDEEEDEEEEEQADPKKPTSDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQVGPETCQETPSQQP
VTPNPTPSTLDISPRRPPGPATSPTSPSLGSPGQRDDLIASLLSEVAPAPLDELRGHKAL
VKLRSRQERELRELHKKHQRKAVALTRRLLDSLAQARAERRCRQRPGVLHRPPSPSPCDN
LSVTQRGSSCRGGEDEKAEEEEVKRYREFQKRQVQSLLELREAQADTEAERRLEHLRQAQ
QRLREIVLDAHATQFKRLKETNEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEIN
RRHITESVNSIRRLEEAQKQRHERLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQ
EACRSLLGETPEGLGDGHLVACASNGHAPGSGGHLSGADSESQEENTKL
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtagag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcttccagtcggaacctg
gtgaccctgcgtgtggaccccaatggcttcttcctgtactggacaggacccaacatggag
gtggacaccctggacatcagttccatcagggacacgcggacgggccgttatgcccgcctg
cccaaggaccccaagatccgagaggtgctgggctttggaggccctgacacccggctggag
gagaagttgatgacagtggtggccgggccagacccggtgaatacaacattcttgaacttc
atggccgtgcaggatgacacagccaaggtctggaccgaggagctgttcaagctggctatg
aacatcctggctcagaacgcctcccggaacacctttctgagaaaagcatacaccaagctg
aagctgcaggtaaaccaggatggacggatcccagtgaagaacatcctgaagatgttctca
gcagataagaagcgcgtcgagactgcgctggaatcctgtggcctcaatttcaaccggagt
gagtccatccggcccgacgagttctccttggaaatcttcgagcggttcctgaataagctg
tgtctgcggccagacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgggacccgaggctcaac
gaagtgctgtatccacccctgcggccctcccaggcccggctgctcattgagaagtatgag
cccaaccagcagttcctggaacgagaccagatgtccatggagggcttcagccgctacctg
gggggtgaggagaatggaatcctgcccttggaggccctggatctgagcgcagacatgacc
cagccgctaagcgcctacttcatcaactcctcacacaacacctatctcacagcggggcag
ctggctgggacgtcgtcggtggagatgtaccggcaggcactgctctggggctgccgctgc
gtggagctggacgtgtggaaagggcggcccccggaggaggagccctttatcacccacggc
ttcaccatgaccaccgaggtgccgctgcgagacgtgctcgaggccattgcggaaaccgcc
ttcaagacctcgccctaccctgtcatcctctccttcgagaaccacgtggactcggcaaag
caacaggcgaagatggccgagtactgtcgttcgatctttggggacgcgctgctcatcgac
ccactggacaagtacccgctggccccaggcgtcccgctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcgacaccagcccagcactggtgtccccaacagc
tccattcgcaagcggccgctggagcagagcagctcggccctgagcgagagctctgccacc
accgagccctcctcgcctcagctcgggtcccccagctctgacagctgcctgggcctgagc
aatggggaagagctgggccttgagaagcccagcctggagcctcggaagtctctgggcgag
gaggggctacagcggggccctgatgctcttggatctgccgaccgtgaggacgaggaggaa
gacgaggaagaggaggaacaggcagatcccaaaaagccgacctcggatgagggcactgcc
agcagtgaagtcaatgccactgaggagatgtcaaccctcgtcaactacatcgagcctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcatccttc
gtggaaaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaat
aaacaacagctcagccgcatctaccccaagggcacccgcgtggactcctccaactacatg
ccccagctcttctggaacgtgggctgccagcttgtggccctcaactttcagaccctggat
gtggcgatgcagctcaacgcgggtgtgtttgagtacaacggacgcagcggctacctgctc
aagcccgagttcatgcggcggccggacaagtccttcgaccccttcaccgaagtcatcgtg
gacggcatcgtggccaatgccttgcgggtcaaggtgatctcggggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccccgttgacacacggcgc
aaataccgcactcggacgtctcaggggaactcattcaatcctgtgtgggatgaggaaccc
tttgacttccccaaggtggtgctccccacgctggcttcgctccgcatcgcggcctttgag
gaaggtggcaagtttgtggggcatcggattctgcccgtctctgccatccgttcagggtac
cactacatttgcctgcggaacgaggccaaccagccgctctgcctgccagccctgctcata
tacaccgaagcctccgactatattcctgatgaccaccaggactacgcagaggccctgatc
aaccccatcaagcatgtcagcctgatggaccagagggccaagcagttggccgccctcatc
ggggagagcgaggctcaggttggcccagaaacctgtcaggagactccatctcagcagccg
gtgaccccaaaccccacacccagcacactggacatctccccgcgccggcccccgggcccc
gccacgtcccctaccagcccctccctcggcagcccagggcagcgcgacgacctcatcgcc
agcctcctctcagaggtggccccggccccgctggacgagctccgaggccacaaggctctg
gtgaaactccggagccgtcaagagcgagagcttcgggagctgcacaagaagcatcagcgg
aaggcggttgccctcactcgccggttgctcgacagcttggcccaggcccgggctgagcgc
aggtgccggcagcggccgggtgtcctacaccgccctcccagcccgagtccctgtgacaac
ctgagtgtcacccagaggggttcttcctgcagaggcggggaggacgagaaggcggaggag
gaagaggtgaagcggtatcgagagttccagaagagacaggtgcagagtctgctggagctg
cgggaggcccaggcggatacagaggccgagcggaggctggagcatctgcgacaggctcag
cagcggctcagggagatcgtcctggatgctcacgccacccagttcaagcggctgaaggag
acgaatgagagggagaagaaggaactgcagaagattctggacaggaagcgccacaacagt
atctcagaagccaagacaagggagaaacataagaaggaggcggaactgacagagattaac
cgtcggcacatcaccgagtccgtcaactccatccgtcggctggaggaggcccagaagcag
cggcacgaacgccttgtggccgggcagcagcaggtgctgcagcagctggccgaagaagag
cccaagctgctggcccaactggcccaggagtgtcaggaacagcgggcaaggctgccccag
gaggcctgccggagcctgctgggcgagacgccggaggggctgggggacgggcatctggtg
gcctgtgccagcaatggtcacgcacctgggagcggcgggcacctgtctggcgctgactca
gagagccaagaggagaatacgaagctctga

DBGET integrated database retrieval system