KEGG   Felis catus (domestic cat): 101090239Help
Entry
101090239         CDS       T02385                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  Jak-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease (IBD)
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101090239 (IL2RG)
   04151 PI3K-Akt signaling pathway
    101090239 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101090239 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101090239 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101090239 (IL2RG)
   04659 Th17 cell differentiation
    101090239 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090239 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    101090239 (IL2RG)
   05340 Primary immunodeficiency
    101090239 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090239 (IL2RG)
   05162 Measles
    101090239 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101090239 (IL2RG)
   04090 CD molecules [BR:fca04090]
    101090239 (IL2RG)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101090239 (IL2RG)
CD molecules [BR:fca04090]
 Proteins
  101090239 (IL2RG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 101090239
NCBI-ProteinID: XP_004000651
Position
X
AA seq 369 aa AA seqDB search
MLKPPLPLRSLLFLQLPLLGVGLNSTGPKPNGNEDITADFFLTATPPAALSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPHPTNLTLHYWYKNSNDDRVQECGHYLFSGEITSGCWLQKE
EIHLYETFVVQLQDPREPKRQSTQRLKLQNLVIPWAPENLTLRNLSETQLELTWSNRHLD
HCLEHLVQYRSDWDRSWTEQSVDHRHSFSLPSVDGQKFYTFRVRSRYNPLCGSAQRWSEW
SRPIHWGSNTSKENPLLFAMEAVLIPLGSVGLIISLICVYCWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPCSQHSPYWAP
PCYTLKPEP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaattcgacaggccccaagcccaatgggaatgaagacatcacagctgatttc
ttcctgaccgctacaccccctgcggccctcagtgtttccactctgcccctcccagaggtc
cagtgttttgtgttcaatgttgagtacatgaattgcacttggaacagcagctctgagccc
catcccaccaacctgactctgcactattggtacaagaactccaatgatgatagagtccag
gagtgtggccactatctattctctggagagatcacttctggctgctggctgcaaaaagag
gagatacatctctatgaaacatttgttgtccagctccaggacccacgggaacccaagagg
cagtccacacagaggctgaaattgcagaatctggtgatcccctgggctccggagaaccta
acgcttcgcaacctgagcgaaacccagctagaactgacctggagtaacagacacttggac
cactgtctggagcaccttgtgcagtaccggagtgactgggaccgcagctggacagaacaa
tcagtggaccacagacatagcttctctctgcctagcgtggatgggcagaaattctacacg
ttccgtgtccggagccgctataacccactctgtggaagcgctcagcgttggagtgaatgg
agccgcccgatccactggggcagcaatacttcaaaggagaatcctttgttgtttgcaatg
gaagctgtgcttatcccccttggctccgtgggattgattattagccttatctgtgtgtac
tgctggctggaacggacgatgccccggattcctaccctcaagaacctagaggatctggtt
actgaataccacgggaacttttcggcctggagtggagtatctaagggactggcggagagt
ctgcagccagactacagtgaatggctctgccacgtcagtgagattcccccaaaaggaggg
gctccaggggaggggcctgggggctccccctgcagccagcatagcccctactgggctccc
ccgtgttacaccctgaaaccggagccctga

KEGG   Felis catus (domestic cat): 101092622Help
Entry
101092622         CDS       T02385                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  Jak-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101092622 (IL2RB)
   04151 PI3K-Akt signaling pathway
    101092622 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092622 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101092622 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101092622 (IL2RB)
   04659 Th17 cell differentiation
    101092622 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092622 (IL2RB)
   05202 Transcriptional misregulation in cancer
    101092622 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101092622 (IL2RB)
   05162 Measles
    101092622 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101092622 (IL2RB)
   04090 CD molecules [BR:fca04090]
    101092622 (IL2RB)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101092622 (IL2RB)
CD molecules [BR:fca04090]
 Proteins
  101092622 (IL2RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 101092622
NCBI-ProteinID: XP_023113240
Ensembl: ENSFCAG00000008405
Position
B4
AA seq 551 aa AA seqDB search
MDVMAAPGLPWCLSLLVLFLPLAIPRASTAVNDPSKLACFYNSKANISCVWSWDGDLQAT
SCRIHAKPDQRSWNKSCELLPMGSASWACYLILGSPDTQSLTSADTVDMRVMCHEGGRWR
VLMTQKFKPFENLRLMAPDSLQVTHVGTHRCNITWKVRQSSHYIERYLEFEARKRSPGHS
WEEASLLTLAQNQQWISLETLTPDTLYELQVRVRPQLGKNEAWSPWSQPLAFRTRPAAPG
KEAVPFPWLGHIIMGISSAFGFIISVYLLANCRYIGPWLKKVLKCHIPDPSEFFSQLKSV
HGGDFQQKWLSSPFPSSSFSPNTPAPEISPLEVLDRDAKATQLLLLQQEKVPSSSSAETS
GHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPCTEEPDEAGPGAPAGSLLPPLLPPP
GEEDAYCTFLLGGPGPPNTAPGGTGAHDKKLAPSLQEGAPRDWAPRPPLSPPPGAPEPVD
IQPPLEGSVEGAREEGPGPGPGPGEGVRVSFPWASPPGQGQLRAPASCLTLNTDAYLSLQ
ELQDQDPARSG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgatggcggctcctggtctgccctggtgtctgtccctccttgtcctcttcctg
cccctggccatccctcgggcatccacagcggtgaacgacccctccaagctcgcgtgtttc
tacaactcaaaagccaacatctcctgtgtctggagctgggatggggacctacaggccaca
tcctgcaggatccacgctaagccggatcaacggtcttggaacaaatcctgtgagctgctt
ccgatgggatcggcctcctgggcctgttacctgatccttggatccccagatactcagagt
ctgacttcggctgacaccgtggacatgagggtgatgtgccacgaaggggggaggtggagg
gtgctgatgacccagaaattcaagccctttgagaaccttcgcctgatggcccccgactcc
ctccaagtcactcacgtagggacccacagatgcaacataacctggaaagtccgccagtcc
tcccactacattgaaagatacctggagtttgaggcccggaaaaggtccccaggccacagc
tgggaggaggcctccctgctgaccctcgcgcagaaccagcaatggatttccctggagacc
ctcactccagacaccctgtatgaacttcaagtgcgggtcaggccccagctgggcaaaaac
gaggcttggagcccctggagccagcccctggccttcaggacgaggcccgcagccccaggg
aaggaggctgtgccctttccttggctgggccacatcatcatgggcatcagcagtgccttt
ggcttcatcatctcggtctacttgctggccaactgccggtacatcgggccatggctgaag
aaagttctgaaatgtcacatcccagatccctcagaattcttctcccagctgaagtcagtg
catggaggagatttccagcagaagtggctctcctctcccttcccctcgtcgtccttcagc
cccaacacgccggcccccgagatctccccgctggaggtgctggacagggacgccaaggcc
acacagttgctcctgctacagcaggagaaggtgccctcctcgtcctcagccgagaccagc
ggccactcgctgaccagctgcttcaccaatcagggctatttcttcttccacctcccggac
gctctggagatcgaggcctgccaggtgtacttcacctatgacccctgcacggaagagccc
gatgaggccgggcccggggcgcctgcggggtctctcctgccacccctgctgcctccgccc
ggggaggaagacgcctactgcaccttcctcctcggcggcccgggccccccaaacacggcc
ccggggggcactggagctcatgacaagaagctggccccctccctgcaggagggagctccc
agagactgggccccccggcccccgctgtctcccccgccaggtgcacctgagccggtggac
atccagccacccctggagggctccgtggaaggagcaagggaggagggcccgggcccgggc
cctggccctggggagggggtcagggtcagcttcccctgggccagccctcctgggcaaggc
cagctcagagcccctgcctcctgcctgaccctgaacaccgatgcctacctgtccctccag
gagctgcaggatcaggacccagctcgctcggggtag

KEGG   Felis catus (domestic cat): 493953Help
Entry
493953            CDS       T02385                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha precursor
  KO
K05068  interleukin 2 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  Jak-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    493953 (IL2RA)
   04151 PI3K-Akt signaling pathway
    493953 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493953 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    493953 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493953 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    493953 (IL2RA)
   04659 Th17 cell differentiation
    493953 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493953 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493953 (IL2RA)
   05162 Measles
    493953 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    493953 (IL2RA)
   04090 CD molecules [BR:fca04090]
    493953 (IL2RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   493953 (IL2RA)
CD molecules [BR:fca04090]
 Proteins
  493953 (IL2RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi
Motif
Other DBs
NCBI-GeneID: 493953
NCBI-ProteinID: NP_001009355
Ensembl: ENSFCAG00000005794
UniProt: P41690
Position
B4
AA seq 275 aa AA seqDB search
MEPSLLLWGILTFVVVHGHVTELCDENPPDIQHATFKALTYKTGTMLNCECKKGFRRISN
GSAFMLCAGNSSHSSWENQCRCISTSPRATDGQIIPKPEEQKGKSPMGMQSQMQPTDQVN
LPGHCREPPPWEHEDSRRIYHFVVGQTVHYQCMQGFRALKRGPAKSVCKTTCGKATWTQP
RLQCLSERSDGWFPDDEEPQASTDAALGSDTSCPSITASTTDFQRHTEVAMTTESFVFTT
EYQIAVAGCVLLLISIVLLSGLTWQRRWRKSRRTI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagccaagcctgctgctgtggggaatcctcacattcgtcgtggtacatggccacgtg
acagaactgtgtgatgaaaacccgccagatatccaacacgccacattcaaagccctcaca
tacaagacgggcaccatgttaaattgtgaatgtaagaagggcttccgcagaataagcaac
gggtcagccttcatgctgtgtgcaggaaactcgagccactcctcctgggaaaaccaatgc
cggtgcataagtacctccccaagggccacagatggacaaattatccctaaacctgaagaa
cagaagggaaaaagccccatgggaatgcagagccaaatgcagcccacggaccaagttaac
cttccaggtcactgcagggagcctccgccctgggaacatgaagattcgaggagaatttac
cattttgtggtggggcagacagttcactaccagtgcatgcagggattcagggccctgaag
aggggtcctgccaagagtgtctgcaaaacgacctgtgggaaggcaacgtggacacagccc
cgactccagtgcctaagcgaaaggagtgatggctggtttccggatgacgaagagcctcaa
gccagcactgatgctgctcttgggagtgacacttcctgtccctcaataacagcaagtact
acagatttccagagacatacggaagtggctatgaccacggagtcattcgtattcacaacc
gagtatcagatagcagtggccggctgcgtcctcctgctgatcagtatcgtccttctgagc
gggctcacctggcagcggagatggaggaagagtagaagaacaatctag

DBGET integrated database retrieval system