KEGG   Felis catus (domestic cat): 101090285Help
Entry
101090285         CDS       T02385                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2
  KO
K05131  interferon receptor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101090285 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    101090285 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101090285 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101090285 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101090285 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    101090285 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    101090285 (IFNAR2)
  09158 Development
   04380 Osteoclast differentiation
    101090285 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090285 (IFNAR2)
  09172 Infectious disease: viral
   05162 Measles
    101090285 (IFNAR2)
   05164 Influenza A
    101090285 (IFNAR2)
   05160 Hepatitis C
    101090285 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    101090285 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101090285 (IFNAR2)
   05169 Epstein-Barr virus infection
    101090285 (IFNAR2)
   05165 Human papillomavirus infection
    101090285 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101090285 (IFNAR2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IFN receptor family
   101090285 (IFNAR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac Interfer-bind
Motif
Other DBs
NCBI-GeneID: 101090285
NCBI-ProteinID: NP_001265788
UniProt: G8IJB6
Position
C2
AA seq 523 aa AA seqDB search
MLWSQNTSWIRPHDLYPVVYLVVCIGLMVGVVSAWPDLSDESCTLKVTFRSFRLILSWEL
KNHSIAPTHYTLWYTVMSKPDDMKIVEHCSNITASFCDLTDVWEVLPETYIPRVDGFRGN
TMLVSCISDFFLATHVSLEPPDFDIVGSTNHINVIVKFPPVIPKILNGELLQYYLPLVIE
EQSGKIVKKHHPKLNGNIIGNVTYVIDKLIPNTNYCVSVYFKSKDMGAINRSPVKCTFLQ
PGQETESSESAKIGGIIIMFLIAAVFISTILILKRVGYICLRNDFPKVLNFNNLSSWVFL
ERPPLETVAFVEVIHVNRKKKVWDYNYDDESDSNDEVAPPISGGGYTMHGLTGRLLGPAS
ASSATLEDCNQPDAEEPDQSEPEADTEPLMAAWPSPGQSECCKSGAYKERGRLPQDPVSE
DDDSASEGSGDKITFNVNLNSVFVRIPDDDSEVPPTSPPFLEETANLEDSDETEISFLAA
SGEGTQPPFASPSAECPWPEDALSDKSDSSESDADIRDGYIMR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctttggagccagaatacttcctggattagaccccatgatttgtatcccgtggtgtat
ctcgtggtgtgtatcggcctcatggttggtgtggtatcggcatggcctgatttgtcagac
gaatcttgtactttaaaggtgacatttcgcagcttccggcttatcttgtcatgggaatta
aaaaaccattcgattgcaccaactcactatacgttatggtacacagtcatgagtaaacca
gacgatatgaagatcgtggagcactgttcaaatatcacagcatcattttgcgacctaacc
gacgtgtgggaagtcctgccagagacatacatccccagagttgatggattcaggggaaac
acaatgctggtcagctgtatcagcgatttcttcctggcaacacacgtgtctttggaacca
cccgactttgatattgttggctctaccaaccacatcaacgtaatagtgaaatttccacca
gtcattcccaagatactaaatggcgagctcttacagtattacttaccgctcgtcatcgaa
gaacagtcagggaagattgttaagaagcatcaccccaagctaaatggaaacatcattgga
aatgtcacttatgtcatcgacaagctgattccaaacacaaactactgtgtatctgtctat
tttaagtctaaagatatgggagcaataaatagatctccagtcaaatgtaccttccttcaa
cctggacaggaaacagagtcatcagaatccgccaaaataggaggaataattattatgttt
ttaatagcagctgtcttcataagcaccatattaatactgaaacgggttggttatatatgc
ttaagaaatgatttccccaaagttttgaattttaataacttgtcatcctgggtctttctc
gagaggccacccttggaaacagtggctttcgtggaggtgattcacgttaacaggaagaag
aaagtgtgggattataattacgacgatgagagcgacagcaatgatgaggtggcccctcca
ataagcggaggtggttatactatgcacgggctaacgggcaggcttctgggtccggcctcc
gcctcctcggccaccttggaagactgcaaccaaccggacgctgaggaacccgatcaatcc
gaacctgaggctgacaccgagcccctgatggcagcatggcccagccccgggcagtcggaa
tgctgcaagagtggggcctacaaggagagagggaggctgccacaggaccccgtctccgag
gatgatgacagcgccagcgaggggtctggggacaaaattaccttcaatgtaaatttaaac
tctgtgtttgtgaggatccccgatgacgactcagaagtacccccgacgtcaccacctttt
ctagaagagacagccaacctagaggattcagatgaaacagaaataagctttctggcagcc
agtggggaaggaacacagccacccttcgccagcccctctgcagagtgcccgtggcctgaa
gacgctctttctgacaaaagtgacagttctgaatcagatgcggacatcagggatggttat
ataatgagatga

KEGG   Felis catus (domestic cat): 101092535Help
Entry
101092535         CDS       T02385                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101092535 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    101092535 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092535 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101092535 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101092535 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    101092535 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    101092535 (IFNAR1)
  09158 Development
   04380 Osteoclast differentiation
    101092535 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092535 (IFNAR1)
  09172 Infectious disease: viral
   05162 Measles
    101092535 (IFNAR1)
   05164 Influenza A
    101092535 (IFNAR1)
   05161 Hepatitis B
    101092535 (IFNAR1)
   05160 Hepatitis C
    101092535 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    101092535 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101092535 (IFNAR1)
   05169 Epstein-Barr virus infection
    101092535 (IFNAR1)
   05165 Human papillomavirus infection
    101092535 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101092535 (IFNAR1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IFN receptor family
   101092535 (IFNAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interfer-bind Tissue_fac fn3
Motif
Other DBs
NCBI-GeneID: 101092535
NCBI-ProteinID: XP_023094563
Ensembl: ENSFCAG00000024317
Position
C2
AA seq 561 aa AA seqDB search
MFSLLGATTLMLVAGAPWTLPAAAGGTNLKSPENVEVHIIDDTFTLRWDGSDPAGGNVTF
SADYQVPRNDTWLKLPGCQSVTSTKCNFSSLKLNVYEKVKLRVRAERGNQTSPWHNVDAF
APFEKAQIGPPKVHLEAEDKAIKINISPPGAKGGVMWALDSSSFTYSLEIWKNSSSAEIK
TKTVYPRDKIYKLSPETTYCLKVKARLLPRKIGAYSPVYCIKTTVENKLPPPENVRIDAV
NDIYVLKWDYASENMTFQAQWLHAYFKKIPGNNSGKWKQMPGCENVKTTQCAIPQNTFQK
GIYLIRVQASDGNTTSVWSKEKRFDAQLQKSVLVPPTINMKPTNEVSLRVFIGAPEESEN
KSVNQHYSLIYEVVFWENTSNAERKTLEKRTDFTFPNLKPLTVYCVKARALTENERWNKS
SVFSDPVCEKTIPGSTSKTWLIAGICAALLSIPVVTYVLKLFLRCVRYVFFPSSKPPSTI
DEYFSEPPLRNLLLFTSEEQTERCFIIENTNIITTVEETEQIGEDHKKYNSQTSQDSGNY
SNEDDSNDSKSGEDFPQQEAE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctcctgggcgcgacgaccctgatgctggttgctggagcgccgtggactttg
cccgcagccgcagggggaacaaatctaaaatctcctgaaaatgtagaggtccacatcatt
gatgataccttcaccctgaggtgggatgggagcgatccagctggcgggaacgtgactttc
tcagcagattatcaagtacccagaaatgatacttggctaaaattgcctgggtgtcaatct
gttaccagcaccaaatgcaacttttcttcgctcaagctaaatgtttacgaaaaagtcaaa
ttgcgtgtaagagcagaaagaggaaaccagacttctccatggcataacgttgacgcattc
gccccatttgaaaaagctcaaattggtcctccaaaagtacatttagaagccgaagataag
gcaataaaaataaacatctccccacctggagcaaaaggtggtgtcatgtgggccctggat
agttcgagttttacatacagcttagagatctggaaaaactcttcaagtgccgaaataaag
actaaaactgtttatcccagagacaaaatttataaactctcaccagagacgacttactgt
ttaaaagttaaagcaagacttttgccgagaaaaatcggtgcctatagtccagtgtattgt
ataaagaccacagttgaaaataagctgcctccgccagaaaacgttcgaatcgatgctgta
aatgacatctatgttcttaagtgggattacgcatctgaaaacatgacttttcaagctcag
tggctccatgcctattttaaaaagattcctgggaacaactcaggtaaatggaaacaaatg
ccaggctgtgaaaatgtcaaaactacccagtgtgccattcctcaaaatactttccagaaa
ggaatttaccttatccgtgttcaagcatctgatggaaataccacatctgtttggtctaaa
gaaaaaagatttgatgctcagttacaaaaaagtgtcctcgttcctccaaccattaacatg
aaacccacgaatgaggtttccctgcgggtctttattggcgctccagaagagtctgaaaac
aagtctgtgaaccagcattactcactaatttatgaagttgtattttgggaaaatacttca
aatgctgagagaaaaactctagagaaaagaactgactttacttttcctaacttgaaacca
ctgactgtgtattgtgtcaaagccagagcactcactgagaatgaaaggtggaataaaagc
agcgtttttagtgatcctgtgtgcgagaaaacaataccaggaagtacttccaaaacatgg
ctcatagctgggatttgtgctgccttattgtccatcccggtcgtcacttacgttctgaaa
ctattcctgcgatgtgtccgttatgtgttcttcccatcaagtaaacctccttccacgata
gatgagtatttctctgagccgccactccggaacctcctccttttcacttctgaagagcaa
actgaaaggtgtttcataatcgaaaatacaaacattatcaccacagtagaagaaactgag
caaatcggtgaagatcacaaaaaatacaattcccaaaccagtcaagattcgggaaattac
tcgaacgaagacgacagcaacgacagcaaaagcggtgaagacttcccgcagcaggaagcc
gagtga

DBGET integrated database retrieval system