KEGG   Felis catus (domestic cat): 101090494Help
Entry
101090494         CDS       T02385                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X3
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04114  Oocyte meiosis
fca04140  Autophagy - animal
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04340  Hedgehog signaling pathway
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04740  Olfactory transduction
fca04742  Taste transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04910  Insulin signaling pathway
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04976  Bile secretion
fca05012  Parkinson disease
fca05020  Prion diseases
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05032  Morphine addiction
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101090494 (PRKACA)
   04010 MAPK signaling pathway
    101090494 (PRKACA)
   04310 Wnt signaling pathway
    101090494 (PRKACA)
   04340 Hedgehog signaling pathway
    101090494 (PRKACA)
   04371 Apelin signaling pathway
    101090494 (PRKACA)
   04020 Calcium signaling pathway
    101090494 (PRKACA)
   04024 cAMP signaling pathway
    101090494 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101090494 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101090494 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101090494 (PRKACA)
   04540 Gap junction
    101090494 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101090494 (PRKACA)
   04062 Chemokine signaling pathway
    101090494 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    101090494 (PRKACA)
   04910 Insulin signaling pathway
    101090494 (PRKACA)
   04922 Glucagon signaling pathway
    101090494 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    101090494 (PRKACA)
   04912 GnRH signaling pathway
    101090494 (PRKACA)
   04913 Ovarian steroidogenesis
    101090494 (PRKACA)
   04915 Estrogen signaling pathway
    101090494 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    101090494 (PRKACA)
   04921 Oxytocin signaling pathway
    101090494 (PRKACA)
   04926 Relaxin signaling pathway
    101090494 (PRKACA)
   04918 Thyroid hormone synthesis
    101090494 (PRKACA)
   04919 Thyroid hormone signaling pathway
    101090494 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    101090494 (PRKACA)
   04916 Melanogenesis
    101090494 (PRKACA)
   04924 Renin secretion
    101090494 (PRKACA)
   04925 Aldosterone synthesis and secretion
    101090494 (PRKACA)
   04927 Cortisol synthesis and secretion
    101090494 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101090494 (PRKACA)
   04270 Vascular smooth muscle contraction
    101090494 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    101090494 (PRKACA)
   04971 Gastric acid secretion
    101090494 (PRKACA)
   04976 Bile secretion
    101090494 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101090494 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101090494 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101090494 (PRKACA)
   04727 GABAergic synapse
    101090494 (PRKACA)
   04725 Cholinergic synapse
    101090494 (PRKACA)
   04728 Dopaminergic synapse
    101090494 (PRKACA)
   04726 Serotonergic synapse
    101090494 (PRKACA)
   04720 Long-term potentiation
    101090494 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    101090494 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    101090494 (PRKACA)
   04742 Taste transduction
    101090494 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    101090494 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    101090494 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    101090494 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101090494 (PRKACA)
   04714 Thermogenesis
    101090494 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090494 (PRKACA)
   05205 Proteoglycans in cancer
    101090494 (PRKACA)
   05203 Viral carcinogenesis
    101090494 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101090494 (PRKACA)
   05020 Prion diseases
    101090494 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    101090494 (PRKACA)
   05031 Amphetamine addiction
    101090494 (PRKACA)
   05032 Morphine addiction
    101090494 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101090494 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101090494 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090494 (PRKACA)
   05163 Human cytomegalovirus infection
    101090494 (PRKACA)
   05165 Human papillomavirus infection
    101090494 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101090494 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101090494 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101090494 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101090494 (PRKACA)
   03036 Chromosome and associated proteins [BR:fca03036]
    101090494 (PRKACA)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101090494 (PRKACA)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKA family
   101090494 (PRKACA)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101090494 (PRKACA)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101090494 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101090494
NCBI-ProteinID: XP_003981984
Ensembl: ENSFCAG00000025137
Position
A2
AA seq 344 aa AA seqDB search
MMASNPNDVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETG
NHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGG
EMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFG
FAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQI
YEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIY
QRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttccaaccccaacgatgtgaaagagttcttagccaaagccaaagaagatttt
cttaaaaaatgggaaaatcctgctcagaatacagcccatttggatcagtttgaacgaatc
aagaccctcggcacgggctcctttgggcgggtgatgctggtaaagcacaaggagaccggg
aaccactttgccatgaagatcctcgacaaacagaaggtggtgaagctgaaacagattgag
cacaccctgaacgaaaagcgcatcctgcaagcggtcaactttccgttcctcgtcaaactc
gagttctccttcaaggacaactcgaacttatacatggtcatggagtacgtgcctggcggg
gagatgttctcacacctgcggcggattggaaggttcagtgaacctcacgcgcgcttttat
gcggcccagatcgtcctgaccttcgagtacctgcactcacttgacctcatctaccgggac
ctgaagccggagaacctcctcattgaccagcagggctacattcaggtgacagacttcggt
tttgccaagcgtgtaaaaggccgcacctggaccttatgcgggacccctgagtacctggcc
ccggagatcatcctgagcaaaggctacaacaaggccgtggactggtgggccctaggggtg
ctcatctacgagatggccgccggctaccctcctttcttcgctgaccagcccatccagatc
tatgagaagattgtctctgggaaggtgcggttcccatcccacttcagctccgacctgaag
gatctgctgcggaacctactgcaggtggacctcaccaaacgctttgggaacctcaagaat
ggagtcaacgatatcaagaaccacaaatggtttgccacaactgactggatcgccatctac
cagaggaaggtggaagctcccttcataccaaagtttaaaggccctggggacacgagtaat
ttcgacgactatgaggaggaagagatccgagtctccatcaatgagaagtgtggcaaggag
tttactgagttttag

KEGG   Felis catus (domestic cat): 101095353Help
Entry
101095353         CDS       T02385                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04114  Oocyte meiosis
fca04140  Autophagy - animal
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04340  Hedgehog signaling pathway
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04740  Olfactory transduction
fca04742  Taste transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04910  Insulin signaling pathway
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04976  Bile secretion
fca05012  Parkinson disease
fca05020  Prion diseases
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05032  Morphine addiction
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05414  Dilated cardiomyopathy (DCM)
Module
fca_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101095353 (PRKACB)
   04010 MAPK signaling pathway
    101095353 (PRKACB)
   04310 Wnt signaling pathway
    101095353 (PRKACB)
   04340 Hedgehog signaling pathway
    101095353 (PRKACB)
   04371 Apelin signaling pathway
    101095353 (PRKACB)
   04020 Calcium signaling pathway
    101095353 (PRKACB)
   04024 cAMP signaling pathway
    101095353 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101095353 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101095353 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101095353 (PRKACB)
   04540 Gap junction
    101095353 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101095353 (PRKACB)
   04062 Chemokine signaling pathway
    101095353 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    101095353 (PRKACB)
   04910 Insulin signaling pathway
    101095353 (PRKACB)
   04922 Glucagon signaling pathway
    101095353 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    101095353 (PRKACB)
   04912 GnRH signaling pathway
    101095353 (PRKACB)
   04913 Ovarian steroidogenesis
    101095353 (PRKACB)
   04915 Estrogen signaling pathway
    101095353 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    101095353 (PRKACB)
   04921 Oxytocin signaling pathway
    101095353 (PRKACB)
   04926 Relaxin signaling pathway
    101095353 (PRKACB)
   04918 Thyroid hormone synthesis
    101095353 (PRKACB)
   04919 Thyroid hormone signaling pathway
    101095353 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    101095353 (PRKACB)
   04916 Melanogenesis
    101095353 (PRKACB)
   04924 Renin secretion
    101095353 (PRKACB)
   04925 Aldosterone synthesis and secretion
    101095353 (PRKACB)
   04927 Cortisol synthesis and secretion
    101095353 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101095353 (PRKACB)
   04270 Vascular smooth muscle contraction
    101095353 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    101095353 (PRKACB)
   04971 Gastric acid secretion
    101095353 (PRKACB)
   04976 Bile secretion
    101095353 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101095353 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101095353 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101095353 (PRKACB)
   04727 GABAergic synapse
    101095353 (PRKACB)
   04725 Cholinergic synapse
    101095353 (PRKACB)
   04728 Dopaminergic synapse
    101095353 (PRKACB)
   04726 Serotonergic synapse
    101095353 (PRKACB)
   04720 Long-term potentiation
    101095353 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    101095353 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    101095353 (PRKACB)
   04742 Taste transduction
    101095353 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    101095353 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    101095353 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    101095353 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101095353 (PRKACB)
   04714 Thermogenesis
    101095353 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095353 (PRKACB)
   05205 Proteoglycans in cancer
    101095353 (PRKACB)
   05203 Viral carcinogenesis
    101095353 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101095353 (PRKACB)
   05020 Prion diseases
    101095353 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    101095353 (PRKACB)
   05031 Amphetamine addiction
    101095353 (PRKACB)
   05032 Morphine addiction
    101095353 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101095353 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101095353 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101095353 (PRKACB)
   05163 Human cytomegalovirus infection
    101095353 (PRKACB)
   05165 Human papillomavirus infection
    101095353 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101095353 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101095353 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095353 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101095353 (PRKACB)
   03036 Chromosome and associated proteins [BR:fca03036]
    101095353 (PRKACB)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101095353 (PRKACB)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKA family
   101095353 (PRKACB)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101095353 (PRKACB)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101095353 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 101095353
NCBI-ProteinID: XP_003990304
Ensembl: ENSFCAG00000027890
UniProt: A0A337S3I6
Position
C1
AA seq 397 aa AA seqDB search
MAAYRELPCNQYTGTTALQKLEGFASRLFHRHSKSTAHDQKTTLENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPTPNNAGLEDFERKKTLGTGSFGRVMLVKHKVTEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFCEF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttatagagaactaccctgtaaccagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacattctaaaagtactgcacatgatcag
aaaacaactctggaaaatgacagccttcatttctctgaacatactgccttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttcttaaaaaatgggaaaatcct
actccgaataatgccgggctggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagtcactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaaaga
atattacaggcggtgaattttccttttcttgttcgactggagtattcttttaaggataat
tctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaaggttatatccaggtcacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagagataatccttagcaag
ggctacaataaggcagtggattggtgggcattaggagtgttaatttatgaaatggcagct
ggataccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttctgga
aaggtccgattcccatcgcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggatttgacgaaacggtttggaaacctgaagaatggtgtgagtgatataaaaact
cacaagtggtttgctacaacagattggattgctatttaccagaggaaggtggaagcacca
ttcataccaaagttcagaggctctggagataccagcaactttgatgactatgaagaagaa
gatatccgtgtctctataacagaaaaatgtgcaaaagaattttgtgaattttaa

DBGET integrated database retrieval system