KEGG   Felis catus (domestic cat): 101090586Help
Entry
101090586         CDS       T02385                                 

Gene name
NCSTN
Definition
(RefSeq) nicastrin
  KO
K06171  nicastrin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04330  Notch signaling pathway
fca05010  Alzheimer disease
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101090586 (NCSTN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090586 (NCSTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nicastrin Ncstrn_small Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 101090586
NCBI-ProteinID: XP_011289415
Ensembl: ENSFCAG00000003928
UniProt: A0A337S9P8
Position
F1
AA seq 709 aa AA seqDB search
MATAGGGSVADPGCRSLLRLLSFCVLLAGLCRGNSVERKIYISLNKTAPCVRLLNATHQI
GCQSSVSGDTGILHVVEKERDLQWVLTDGPNPPYVVLLEGELFTRNLMEKLKGTTSRIAG
LAVSLAKPRPASGSSPSVQCPNDGFGIYSNSYGPEFAHCREIPWNPLGDGLAYEDFSFPI
FLLEDENETKVIKQCYRDHNLSPNGSAPTFPLCAMQLFSHMHAVISTVTCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINISGALEPDDRVVVAATRLDSRSFFWNVAPGAESAVA
SFVTQLAAAEALQKAPDALTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENID
SFVELGQVALRNSLELWMHTDPMSQKNESVHNQVEALLSTLEKSGAGVPAVVLRRPNQSQ
PLPPSSLQRFLRARNISGVVLADHSAVFHNHYYQSIYDTAENINVSYPEWQSPEEDLNFV
TDTAKALADVATVLGRALYQLAGGTNFSDTIQADPQTVTRLLYGFLVRANNSWFQSILRQ
DLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGQVVDLPREQCQDPSKVPSENKDLY
EYAWVQGPLNSNETDRLPRCVRSTARLARALSPAFELRQWGSTEYSTWTESRWKDIRARI
FLVASRELEFITLMVGFGILVFSLVVTYCINAKADVLFITPREPGAVSY
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgggggcggttctgtggccgacccgggctgtcggagtcttcttcgcctt
ctgtctttctgcgtcctgctggcaggtttgtgcaggggaaactcagtggagaggaagatc
tacatctccttaaataaaacagctccttgtgtccgtctgctcaacgccactcatcagatt
ggctgccagtcttccgttagcggggacacagggatcctccacgtggtggagaaagaaagg
gacctgcagtgggtgctgactgacggccccaaccccccgtatgtggttctgctggagggc
gagctcttcaccaggaatctgatggagaagctgaaggggacaaccagccggattgctggc
cttgcagtgtccttggccaaacccaggcctgcgtcgggctcctctcctagtgtgcagtgt
cccaatgatgggtttggcatttactccaactcgtatgggccagaatttgctcactgcaga
gaaatcccgtggaaccccctaggcgacggcttggcttatgaagactttagcttccccatc
ttccttcttgaagatgaaaatgaaaccaaggtcatcaagcagtgctatcgcgatcacaac
ctgagccccaacggctcagcacccaccttcccgctgtgcgccatgcagctcttctcccac
atgcacgctgtcatcagcactgtcacctgtatgcggcgcagctccatccagagcaccttc
agcatcaacccagaaatcgtctgtgaccccctgtccgactacaacgtgtggagcatgctt
aagcctataaatatatctggggcattagagcctgatgacagggttgtggtcgctgccacc
cggctggacagtcgttcctttttctggaacgtggccccaggggctgaaagtgccgtcgcc
tccttcgtcacccagctggctgccgctgaagctttgcagaaggcacctgatgcgctgacc
cttccccgcaatgtcatgtttgtcttcttccaaggggagacgtttgactacatcggcagc
tccaggatggtgtacgacatggagaagggcaagtttcctgtgcagttagagaacattgac
tcgttcgtggagctgggacaggtggccttaaggaattctctagagctctggatgcacaca
gaccccatgtcccagaaaaatgagtctgtacacaatcaggtggaggccctcctgagcacc
ctggagaagagcggggccggcgtccctgctgtggtcctccggaggccgaaccagtcccag
cccctcccgccgtcttctctgcagaggtttcttcgggctcggaacatctctggtgtcgtc
cttgccgaccactctgctgtcttccataaccactattaccagagcatttacgacacagcg
gagaacattaacgtgagctaccccgagtggcagagccccgaagaggacctcaactttgtg
acggacactgccaaggccctggcggatgtggccacggtgctgggacgtgccctctaccag
ctggcaggaggaaccaacttcagtgacaccattcaggccgatccccaaacggtcactcgc
ctgctctatgggttcctggtcagggccaacaactcctggttccagtccatcctcaggcag
gacctgaggtcctacttgggtgacgggcctcttcagcattacatcgccgtctccagcccc
accaacaccacctacgtggtacagtatgccttggcgaatctgactggccaggtggtcgac
ctcccccgagagcagtgccaggatccaagtaaagtccccagtgaaaacaaggatctgtat
gagtacgcatgggttcagggccctctgaactccaacgagacggaccggctgccccgctgt
gtgcgttccacggcgcgactggccagggccctgtcccctgcctttgaactgaggcagtgg
ggctctactgaatactccacatggactgagagccgctggaaagacatccgggcccgcata
tttctggtagccagcagagagctggagttcatcaccctgatggtgggcttcggcatcctc
gtcttctctctcgtcgtcacctactgcatcaacgccaaggccgacgtccttttcatcacc
cctcgggagccaggagccgtgtcttactga

DBGET integrated database retrieval system