KEGG   Felis catus (domestic cat): 101090663Help
Entry
101090663         CDS       T02385                                 

Gene name
STAT5B
Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04062  Chemokine signaling pathway
fca04217  Necroptosis
fca04630  Jak-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04917  Prolactin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05161  Hepatitis B
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
Module
fca_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101090663 (STAT5B)
   04630 Jak-STAT signaling pathway
    101090663 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101090663 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101090663 (STAT5B)
   04659 Th17 cell differentiation
    101090663 (STAT5B)
   04062 Chemokine signaling pathway
    101090663 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101090663 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090663 (STAT5B)
   05203 Viral carcinogenesis
    101090663 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101090663 (STAT5B)
   05220 Chronic myeloid leukemia
    101090663 (STAT5B)
   05223 Non-small cell lung cancer
    101090663 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101090663 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090663 (STAT5B)
   05162 Measles
    101090663 (STAT5B)
   05161 Hepatitis B
    101090663 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101090663 (STAT5B)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    101090663 (STAT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Motif
Other DBs
NCBI-GeneID: 101090663
NCBI-ProteinID: XP_023100377
Position
E1
AA seq 787 aa AA seqDB search
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPVGNLADTMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSXDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVNASADSAG
ASATYMDQAPSPAVCPQAHYNMYPQNPDPVLDNDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggtgatgcccttcatcagatgcaagca
ttatatggtcaacatttccccattgaggtgcgacattatttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactatgccacgcagctccagaacacatatgaccgc
tgccccatggagctggtccgctgcatccggcatattctctacaacgagcagaggctggtc
cgcgaagccaacaatggtacttctccagttggaaatcttgctgacaccatgtcccagaaa
cacctccagatcaaccagacgtttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaatccgcaggagcgcctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgggaggcccag
acgctgcagcagtaccgtgtggagctggccgagaagcaccagaagaccttgcagctgctg
cggaagcagcagaccatcattctggatgatgaactgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcnctgatgtgctgcagtcctggtgcgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagagctgagcacctctgc
cagcagctgcccatccctggcccagtggaggagatgctagctgaggtcaatgccaccatc
acagacatcatctcagccctggtgaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagcgacggtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tcactgctcaagaatgagaacacccgcaacgactacagtggagagatcctgaacaactgc
tgtgtgatggaataccaccaagccaccggcaccctgagtgcgcacttcaggaacatgtcc
ctgaagcgaattaagaggtctgaccgtcgtggagcagagtcagtgactgaagaaaaattt
acaatcctgttcgaatcacagttcagtgttggtggaaatgagctggtttttcaggtcaag
actctctccctcccggtggtggtgattgtccatggcagccaggacaacaatgcgacggcc
actgttctttgggacaatgcttttgcagagcctggcagggtgccatttgccgtgcccgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcacagaaactgttcaacagc
agcagcagccaccttgaagactataatggcatgtccgtgtcctggtcccagttcaacagg
gagaatttgccaggacgaaattacactttctggcagtggtttgatggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggccattttgggtttcgtgaacaag
caacaggcccatgacctactcattaacaagcctgatgggaccttcttgctgagattcagc
gactctgaaatcggtggcatcaccattgcttggaagtttgattctcaggaaaggatgttt
tggaatctgatgccttttaccaccagagacttctccatccggtccctggctgaccgctta
ggggacctgaattaccttatctacgtgtttcctgatcggccaaaagatgaagtgtactcc
aaatactacacaccagtcccatgcgagcctgccactgctaaagcggtggacggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgaatgcgtctgcagactctgccggg
gccagcgccacctacatggaccaggccccctccccagccgtgtgcccccaggctcattat
aacatgtacccacagaaccctgaccccgtccttgacaatgatggggactttgatctggat
gacacaatggatgtggcgcggcgtgtggaagagctcttgggccgacctatggacagtcag
tggatccctcacgcgcagtcatga

KEGG   Felis catus (domestic cat): 101090913Help
Entry
101090913         CDS       T02385                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A isoform X1
  KO
K11223  signal transducer and activator of transcription 5A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04217  Necroptosis
fca04630  Jak-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04917  Prolactin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05161  Hepatitis B
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
Module
fca_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101090913
   04630 Jak-STAT signaling pathway
    101090913
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101090913
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101090913
   04659 Th17 cell differentiation
    101090913
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101090913
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090913
   05203 Viral carcinogenesis
    101090913
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101090913
   05220 Chronic myeloid leukemia
    101090913
   05223 Non-small cell lung cancer
    101090913
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101090913
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090913
   05162 Measles
    101090913
   05161 Hepatitis B
    101090913
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101090913
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    101090913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Motif
Other DBs
NCBI-GeneID: 101090913
NCBI-ProteinID: XP_023099834
Position
E1
AA seq 794 aa AA seqDB search
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAHWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADSAGASATY
MDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDGRTTGMA
ERNLFVSERRSSSP
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctggatccaagcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctgtacgggcagcacttccccatcgaggttcggcactacttagcgcattggatcgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgagcccaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactatgccacgcagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccggcatattctgtacaacgaacagaggctggtc
cgagaagccaacaatggtagttctccagctgggatcctggtggacgccatgtcccagaaa
cacctccagatcaaccagacgtttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaatccgcaggagcgcctgagccgg
gagacggccctccagcagaagcaggtgtccctggaggcctggctgcagcgggaggcccag
acgctgcagcagtaccgtgtggagctggccgagaagcaccagaagaccttgcagctgctg
cggaagcagcagaccatcattctggatgatgaactgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggatgtgctgcagtcctggtgcgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagagctgagcacctctgc
cagcagctgcccatccctggcccagtggaggagatgctagctgaggtcaatgccaccatc
acagacatcatctcagccctggtgaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagcgacggtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tcactgctcaagaatgagaacacccgcaacgactacagtggagagatcctgaacaactgc
tgtgtgatggaataccaccaagccaccggcaccctgagcgcacacttcaggaacatgtca
ctaaagagaattaagcgtgctgaccggaggggcgcagagtctgtgacggaggagaagttc
acagtcctgtttgagtctcagttcagtgtcggcagcaatgagcttgtgttccaagtaaag
actctgtcccttcccgtggttgtcatcgttcatggcagccaggaccacaacgctaccgcc
actgtgctgtgggacaacgccttcgctgagccgggcagggtgccatttgccgtgcccgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcacagaaactgttcaacagc
agcagcagccaccttgaagactataatggcatgtccgtgtcctggtcccagttcaacagg
gagaacttgccaggctggaactacaccttctggcagtggttcgatggggtcatggaggtg
ctgaagaagcatcacaagcctcattggaatgacggggccatcctaggctttgtgaataag
caacaggcccatgacctgctcatcaacaaacccgacggaacctttttattgcgctttagc
gactctgaaatcgggggcatcaccattgcctggaagtttgactctcctgaccgcaacctt
tggaacctgaagccattcaccacgcgggacttctccatccggtccctggctgaccggctg
ggggacctgagctatctcatctatgtatttcccgaccgacccaaggatgaggtcttctcc
aagtattacacccctgtgctcgctaaagcggtggacggatacgtgaagccacagatcaag
caagtggtccctgagtttgtgaatgcgtctgcagactctgccggggccagcgccacctac
atggaccaggccccctccccagccgtgtgcccccaggctcattataacatgtacccacag
aaccctgaccccgtccttgaccaggatggagaatttgacctggatgagaccatggatgta
gccaggcatgtggaggaactcttacgccgcccgatggacggcaggacgacagggatggcc
gagcgcaacctgtttgtctcggagagaaggtcctcatccccttaa

KEGG   Felis catus (domestic cat): 101095698Help
Entry
101095698         CDS       T02385                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04217  Necroptosis
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04630  Jak-STAT signaling pathway
fca04659  Th17 cell differentiation
fca04917  Prolactin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04931  Insulin resistance
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05145  Toxoplasmosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05212  Pancreatic cancer
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease (IBD)
Module
fca_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101095698 (STAT3)
   04066 HIF-1 signaling pathway
    101095698 (STAT3)
   04068 FoxO signaling pathway
    101095698 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101095698 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101095698 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101095698 (STAT3)
   04062 Chemokine signaling pathway
    101095698 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101095698 (STAT3)
   04917 Prolactin signaling pathway
    101095698 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095698 (STAT3)
   05206 MicroRNAs in cancer
    101095698 (STAT3)
   05205 Proteoglycans in cancer
    101095698 (STAT3)
   05203 Viral carcinogenesis
    101095698 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101095698 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101095698 (STAT3)
   05221 Acute myeloid leukemia
    101095698 (STAT3)
   05223 Non-small cell lung cancer
    101095698 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    101095698 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101095698 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101095698 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    101095698 (STAT3)
   05161 Hepatitis B
    101095698 (STAT3)
   05160 Hepatitis C
    101095698 (STAT3)
   05163 Human cytomegalovirus infection
    101095698 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095698 (STAT3)
   05169 Epstein-Barr virus infection
    101095698 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101095698 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101095698 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101095698 (STAT3)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    101095698 (STAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 Syntaxin-6_N
Motif
Other DBs
NCBI-GeneID: 101095698
NCBI-ProteinID: XP_003996930
Ensembl: ENSFCAG00000002154
UniProt: M3VY01
Position
E1
AA seq 770 aa AA seqDB search
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacacggtacctggagcagcttcatcag
ctgtacagtgacagcttcccaatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatatgcggccagcaaagaatcacatgctactttggtgtttcataatctc
ttgggtgagattgaccagcagtacagccgtttcctacaggaatcgaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcaggtatctggagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctgctccagactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacggccgccgtggtgacggagaag
cagcagatgctggagcagcacctgcaagatgttcggaagcgagtacaggacctagaacag
aaaatgaaagtggtagagaacctccaggatgactttgacttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtccgtgaccaggcagaagatg
cagcagctggaacagatgctcacggcgctggaccagatgcggcgcagcatcgtgagtgag
ttggcggggctgttgtcagccatggagtatgtgcagaagacgctcacggatgaagagctg
gctgactggaagaggcggcagcagattgcgtgcatcgggggcccgcccaacatctgcctc
gaccgcctagaaaactggataacctcgttagcggaatctcaacttcagacgcgccaacaa
attaagaaactggaggagttgcagcaaaaagtgtcctacaaaggggatcccattgtacag
caccggccaatgctggaggagaggattgtggagctgtttagaaacttaatgaaaagtgcc
tttgtggttgagcggcagccctgcatgcccatgcatcccgaccggccattggtcatcaag
actggcgtccagttcactaccaaagtcagattgctggtcaaattccctgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggatgttgcagctctcagagga
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtccaac
aacggcagcctctctgcagaattcaaacatctgaccctgagagagcaaagatgtggtaac
gggggccgagccaattgtgatgcctccctgattgtcaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccagggcctcaagattgaccttgagacccactccttgcca
gttgtggtgatctccaacatctgtcagatgcctaatgcctgggcatctatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccgattggaacc
tgggatcaagtggctgaggtgctgagctggcagttctcctccactacaaagcgaggcctg
agcatcgagcagttgacgacgctggcagagaagctcttaggacctggtgtgaactattca
gggtgtcagattacgtgggctaaattttgcaaagaaaacatggccggcaaaggcttctcc
ttctgggtctggctagacaatatcattgatcttgtgaaaaagtacatcctggctctttgg
aacgaagggtacataatgggttttatcagtaaggagcgggagcgggccatcttgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggtgtcacc
ttcacttgggtggagaaggacatcagcggcaagacccagatccagtccgtggaaccatat
accaagcagcagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgctaccaacatcctcgtgtctccgctggtttatctctacccggacattcctaaggag
gaggcgtttggaaagtattgtcgaccagaaagccaggagcatcctgaagctgacccaggt
agtgctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcagtttgaatccctcacgttcgacatggag
ttgacctcggagtgcgccacctccccaatgtga

DBGET integrated database retrieval system