KEGG   Felis catus (domestic cat): 101090833Help
Entry
101090833         CDS       T02385                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2 isoform X1
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04218  Cellular senescence
fca04370  VEGF signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04722  Neurotrophin signaling pathway
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101090833 (MAPKAPK2)
   04370 VEGF signaling pathway
    101090833 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101090833 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101090833 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101090833 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101090833 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101090833 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101090833 (MAPKAPK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101090833 (MAPKAPK2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   101090833 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 101090833
NCBI-ProteinID: XP_023103823
Ensembl: ENSFCAG00000013513
Position
F1
AA seq 405 aa AA seqDB search
MLSNSQGQTPPVLFPNPPPPPPPQPPAPAQPHPPTQPPPQPPQQFPQFHVKSSLQIKKNA
IIDDYKVTTQVLGLGINGKVLQILNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIV
RIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTERGRKEASEIMKSIGEAIQ
YLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVL
GPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVS
EEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEE
MTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaactctcaaggccagaccccaccggtgctgtttcccaacccgccgccgccg
ccgccgccgcagccccccgccccggcccagcctcaccccccgacccagccgccgccgcag
cccccgcagcagtttccccagttccacgtcaagtcgagcctgcagatcaagaagaacgcc
atcatcgacgactacaaggtcaccacccaggtcctcggactgggtatcaacgggaaagtt
ttgcagatcctcaacaagaggacccaggagaaattcgccctaaaaatgcttcaggactgc
cccaaggcccgccgggaggtcgagctgcactggagggcttcccagtgcccacacatcgtg
cggatcgtcgatgtctacgagaacctgtacgcggggaggaagtgcctgctcattgtcatg
gaatgtctggatggcggagagctctttagccgaatccaggaccgaggagaccaagcgttc
acagaaagaggtagaaaggaagcgtcagaaatcatgaagagcatcggtgaggccatccag
tatctgcactcaatcaacattgcccatcgggatgtcaagcctgagaacctcctatacacc
tccaaaaggcccaatgccattctgaaactcaccgattttggctttgccaaggaaaccacc
agccacaattctttgaccactccttgttatacgccgtactatgtggctccggaagtgctg
ggtccagagaagtatgacaagtcctgtgacatgtggtccttgggtgtcatcatgtacatc
ctgctgtgtgggtatccccccttctactccaaccatggtcttgccatctctccgggcatg
aagactcgcatccgaatgggccagtatgaatttcccaacccagaatggtccgaagtgtca
gaggaagtgaagatgcttatccggaacctgctgaaaacagagcccacacagaggatgacc
atcacggagtttatgaaccacccctggatcatgcaatccacaaaggtccctcagacccca
ctgcacaccagccgggtcctgaaggaggacaaggagcggtgggaggatgtcaaggaggag
atgaccagtgccttggccacaatgcgcgtcgactacgagcagatcaagataaaaaagatt
gaagatgcgtccaatcctctccttctgaagaggcggaagaaagctcgggccctggaggct
gcggccctcgctcactga

DBGET integrated database retrieval system