KEGG   Felis catus (domestic cat): 101090983Help
Entry
101090983         CDS       T02385                                 

Gene name
DNM3
Definition
(RefSeq) dynamin-3 isoform X1
  KO
K01528  dynamin GTPase [EC:3.6.5.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101090983 (DNM3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101090983 (DNM3)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101090983 (DNM3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101090983 (DNM3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101090983 (DNM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101090983 (DNM3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090983 (DNM3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     101090983 (DNM3)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    101090983 (DNM3)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101090983 (DNM3)
   RhoA-dependent endocytosis
    101090983 (DNM3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090983 (DNM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 TetR_C_27
Motif
Other DBs
NCBI-GeneID: 101090983
NCBI-ProteinID: XP_023103675
Ensembl: ENSFCAG00000013529
Position
F1
AA seq 874 aa AA seqDB search
MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
DIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
QGQLLSIEHEVEAHKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
IQVSYINTNHEDFIGFANAQQRSSQVHKKNTIGNQGTNLPPSRQIVIRKGWLTISNIGIM
KGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR
NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSLGNNKTENDDNGQAENFSMDPQLE
RQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLME
ESAEQAQRRDEMLRMYQALKEALVIIGDINTATTFTPAPPPVDDSWIQHSRRSPPPSPTT
QRRLTLSGPLTRPASGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSSDWSGAPPQVP
SRPTRAPPSVPSRRPPPSPTRPTIIRPLESSLLD
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgggagatggaggagctgatcccgctggtgaaccgtctgcaggacgccttc
tcggcgctgggacagagctgcctgctggagctgccgcagatcgccgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaacttcgtgggcagggactttctccctcgaggg
tcgggcattgtaaccagacggcctcttgtgctgcagcttgttacttccaaagcagagtat
gctgaatttctacattgcaaaggaaaaaaatttacagattttgatgaagttcgccatgag
attgaagcagaaacagatcgagtgactggaatgaataaaggcatttcctccatacccatt
aatttacgagtctattctccacatgtgttaaatctcacacttatcgacctacctggaatt
actaaagtgcccgtgggagatcagccaccagatattgagtatcagatcagagaaatgatt
atgcagttcatcacgcgggagaactgtctcattttggctgttactccagccaacaccgat
cttgcaaactcagatgcattgaagctagctaaagaagttgatcctcaaggtttaagaacc
attggagtcatcaccaaattggatcttatggatgaaggaacagatgccagggatgttctg
gagaacaagcttctgcctcttcgcaggggttacgtgggggtggtaaacagaagccagaag
gacatagatgggaagaaggacattaaggctgccatgttggcggaaaggaaatttttcctc
tcacacccagcttacagacatattgctgataggatggggaccccacacctgcagaaggtc
cttaatcagcaacttaccaaccacattcgagataccctgccaaacttcaggaacaaacta
cagggacagttgctctccattgaacatgaagtggaagcccataaaaacttcaagcccgaa
gaccccaccaggaagaccaaagcgttgttgcagatggttcagcaatttgctgtggacttc
gagaagagaattgaagggtcaggggatcaagtagatacgctggagctctcaggaggggct
aaaattaaccgtattttccatgaacgctttccttttgagatagtaaagatggagttcaat
gagaaagaattacgaagagaaataagctatgcaatcaaaaacatacatggtatcaggacg
gggttgtttactccagacatggcatttgaagcaatagtcaaaaaacaaattgtaaagctt
aaaggaccgtccttgaagagtgtagatctggtaatacaagaattaatcaataccgtcaag
aagtgtaccaaaaaactggcaaacttccccagactctgcgaggaaacagaaaggattgtt
gccaaccatattcgcgagcgagaagggaagacaaaggaccaggtactgctactgattgac
atccaagtctcttacatcaacaccaaccacgaagatttcattggatttgcaaatgctcag
cagaggagcagtcaggttcacaagaaaaacacaattggaaatcagggaaccaatcttccg
ccttcaaggcaaattgtgattcgtaagggatggttaaccatcagcaacattggcatcatg
aaaggaggctctaagggatactggttcgtccttactgctgaaagcttgtcctggtacaaa
gatgacgaggaaaaagaaaagaagtatatgcttcccttggacaacctgaaagttcgggat
gtggaaaaaagctttatgtctagcaagcacatctttgcactttttaatacagaacaaagg
aatgtatacaaagactatcgcttccttgagctggcatgtgactcacaggaggatgtggac
agctggaaggcatctctactaagagctggggtttatcctgataaatctttagggaacaac
aaaactgaaaatgatgataatggccaggcagaaaacttttccatggacccacagttggag
aggcaagtggagaccattcgcaacctcgtagactcctacatgtctatcatcaacaaatgt
atccgagatctaattccaaaaacaataatgcaccttatgatcaacaatgttaaagatttc
atcaattcggagctcctagcacagttatattcttcggaggaccagaacactctgatggag
gaatctgctgaacaggcgcagcgccgggatgagatgcttcgaatgtaccaagcccttaaa
gaggccctcgtgatcattggtgacatcaacaccgccaccactttcacccctgcaccgcct
cctgtggatgactcctggatacagcactcccgcaggtcaccccctccgagccccaccacc
cagaggcggctgaccctgagcggtcccctcacgcggcccgcatccggcagagggcccgcg
ccggccattccctctcccggcccccactcgggggcgccccccgtgcccttccggcccggc
ccgctgccccctttccccagcagcagcagcgactggtccggagcgccccctcaagtgccc
tcccggcccacgagggccccgcccagtgtccccagccggagaccacccccatcaccaact
cgtcccactataatccgtccactagaatcctccctgttagactaa

KEGG   Felis catus (domestic cat): 101100788Help
Entry
101100788         CDS       T02385                                 

Gene name
DNM2
Definition
(RefSeq) dynamin-2 isoform X1
  KO
K01528  dynamin GTPase [EC:3.6.5.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101100788 (DNM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101100788 (DNM2)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101100788 (DNM2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101100788 (DNM2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101100788 (DNM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101100788 (DNM2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101100788 (DNM2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     101100788 (DNM2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    101100788 (DNM2)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101100788 (DNM2)
   RhoA-dependent endocytosis
    101100788 (DNM2)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101100788 (DNM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 PH_11
Motif
Other DBs
NCBI-GeneID: 101100788
NCBI-ProteinID: XP_023101136
Ensembl: ENSFCAG00000004892
Position
A2
AA seq 877 aa AA seqDB search
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGKKDIRTALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANCYYTEQLVTGAQQRSTQLNKKRAIPNQGEILVIRRGWLTINN
ISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFN
TEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGVQENTFSMDPQLE
RQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLME
ESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWIQSSSSHSPTPQRR
PISSVHPPGRPPAVRGPTPGPPLIPMPAASFAAPPIPSRPGPQSVFANNDPFSAPPQIPS
RPARIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccgcgggatggaagagctgatcccgctggtcaacaagctgcaggacgctttc
agctccatcggccagagctgccacctggacctgcctcagatcgccgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaacttcgtaggccgggacttccttccccgaggt
tcaggaatcgtcacccggcggcctctcattctgcagctcatcttctcaaaaacagaatat
gccgagtttttgcactgtaagtccaaaaagtttacagactttgatgaagtccgacaggag
atcgaagcggagaccgacagggtcacggggaccaacaaaggcatctccccagtgcccatc
aacctgcgggtctactcgccacacgtgttgaacctgaccctcatcgacctcccgggtatc
accaaggtgcccgtgggggaccagcccccagatatcgagtaccagatcaaggacatgatc
ctgcagttcatcagccgggagagcagtctcatcctcgccgtcacccctgccaacatggac
ctggccaactcagatgccctcaagctggccaaggaggtcgacccccaaggcctgcggacc
attggcgtcatcaccaagctcgacctgatggatgaaggcactgatgccagggacgtcctg
gaaaacaagttgctccccttgagaagaggctacatcggtgtggtgaaccgcagccagaag
gacattgagggcaagaaggacatccgcacggcactggcggccgagaggaagttcttcctc
tcccacccagcctaccggcacatggctgaccgcatgggcaccccacacctgcagaagacc
ctgaaccagcaactgaccaaccacatccgggagtccctgccagccctgcggagcaagctg
cagagccaactgctgtccctggagaaggaggtggaggagtacaagaacttccggcccgat
gaccccactcgcaaaaccaaagccttgctgcagatggtccagcagtttggggtggacttc
gaaaagaggatcgaaggctctggagaccaagtggacacgctagaactctccgggggtgcc
cgaatcaatcgcatcttccacgagcggtttccctttgagctggtgaagatggagttcgac
gagaaggatttacggcgcgagatcagctacgccattaagaacatccacggagtcaggacc
gggctcttcaccccggacttggcattcgaggccattgtgaaaaagcaggtcgtcaagctg
aaagagccctgtctgaaatgtgtcgacctggttatccaggagctaatcaatacagttagg
cagtgtaccagtaagctcagctcctacccccgcttgcgagaagagacggagcgaatcgtc
accacgtacatccgggaacgggaggggagaaccaaggaccagattcttcttctgatcgac
atcgagcagtcctacatcaacacgaaccacgaggactttattggatttgccaactgttat
tatactgagcagctggtgaccggcgcccagcagaggagtacacagctgaacaagaagaga
gccatccccaaccagggggagatcttggtgatccgcaggggctggttgaccatcaacaac
atcagtctgatgaagggcggctccaaggagtactggtttgtgctgacggccgagtctctg
tcctggtacaaggatgaggaggagaaggagaagaagtacatgctgcctctggacaacctg
aaaatccgcgacgtggagaaaggcttcatgtccaacaagcacgtcttcgccatcttcaac
acggagcagaggaacgtctacaaggacctgcggcagatcgagctggcctgtgactcccag
gaggacgtggacagctggaaggcctcgttcctccgagctggggtctaccccgagaaggac
caggcagagaatgaggacggggtccaggagaacaccttctccatggacccgcagctggag
cgccaggtggagaccattcgcaacctggtggactcctatgtggccatcatcaacaagtcc
atccgtgacctcatgccaaagaccatcatgcacctcatgatcaacaacacgaaggccttc
atccaccacgagctgctggcctacctgtactcctcggcggaccagagcagcctcatggag
gagtcggccgaccaggcccagaggcgagacgacatgctgcgcatgtaccatgcgctcaag
gaggccctcaacatcatcggggacatcagcaccagcaccgtgtccacgcccgtgcccccg
cccgtcgatgacacctggatccagagctccagcagccacagccccactccacagcgccga
cccatatccagcgtgcatcccccaggccggcccccggcagtgagaggcccgaccccgggc
ccccccctgattcccatgccggcagcctcctttgccgcaccccccatcccgtccaggcct
ggaccccagagcgtgtttgccaacaatgaccccttctcggccccgcctcagatcccgtct
aggccggctcggattccacccggcatcccccctggagtgcccagcagaagaccccctgct
gcgcccagccggcccaccattatccgcccagccgagccatccctgctcgactag

KEGG   Felis catus (domestic cat): 654421Help
Entry
654421            CDS       T02385                                 

Gene name
DNM1
Definition
(RefSeq) dynamin-1 isoform X1
  KO
K01528  dynamin GTPase [EC:3.6.5.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    654421 (DNM1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    654421 (DNM1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    654421 (DNM1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    654421 (DNM1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    654421 (DNM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    654421 (DNM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    654421 (DNM1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     654421 (DNM1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    654421 (DNM1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    654421 (DNM1)
   RhoA-dependent endocytosis
    654421 (DNM1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   654421 (DNM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 AAA_28 PH_11
Motif
Other DBs
NCBI-GeneID: 654421
NCBI-ProteinID: XP_023098543
Position
D4
AA seq 868 aa AA seqDB search
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKL
KEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKASGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDNFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPSRKGPASPTRPVVPRPAEAPLLDL
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgcggcatggaggatctcatcccgctggtcaaccggctgcaggacgccttc
tccgctatcggccagaacgcggacctcgacctgccgcagatcgccgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaatttcgtcggcagagacttcctgccccgaggg
tcaggcatcgtcacccgacgccccctggtcctgcagctggtcaatgccaccacagaatat
gccgaattcttgcactgcaaggggaagaaattcaccgactttgaggaggtgcgtctggag
atcgaggctgagaccgaccgagtcactggcactaacaagggcatctcgccggtgccgatc
aacctccgcgtctactcgccgcacgtgctgaacctgacactggtggacctgcccggaatg
accaaggtcccggtgggggaccaacctcctgacatcgagttccagatccgggacatgctt
atgcagttcgtcaccaaagagaactgcctcatcctggctgtatccccggccaactccgac
ctggccaactccgatgctctgaaggttgccaaggaggtggacccccagggccagcgcacc
atcggggtcatcaccaagctggacctaatggacgagggcacagatgcccgtgatgtgctg
gagaacaaactgctccccctgcgcagaggctacattggggtggtgaaccggagccagaag
gacattgatggcaagaaggacatcacggcggccttggccgctgaacgcaagttcttcctc
tcccatccgtcctaccgccacttggctgaccgcatgggcacgccctacctgcagaaggtc
ctcaaccagcaactgaccaaccacatccgggacaccctgccggggcttcggaacaagctg
cagagccagctcctgtccatcgagaaggaggtggaggagtacaagaacttccggccagat
gacccagctcgcaagaccaaggctctgctgcagatggtccagcagtttgccgtggacttt
gagaagcgcattgagggctcaggggaccagatcgacacctatgaactgtcagggggagcc
cgcatcaaccggatcttccatgagcgcttcccctttgagctagtcaagatggagtttgat
gagaaggagctccgaagagagatcagctacgccatcaagaatatccatggcattaggacg
ggcctcttcacacctgacctcgcttttgaagccacagtgaaaaagcaggtgcagaagctc
aaagagcccagtatcaagtgtgtggatatggtagtcagtgagctcacggccaccatcaga
aagtgtagcgaaaagctccagcagtacccccgcctgcgggaggagatggagcgcatcgtg
accacccacatccgggagcgcgagggtcgcaccaaggagcaggtcatgcttctcatcgat
attgagttggcttacatgaataccaatcatgaggacttcataggctttgccaatgctcag
cagaggagcaaccagatgaacaagaagaaggcttcagggaaccaggatgagattctggtc
atccggaagggctggctgaccatcaacaacattggcatcatgaaggggggctccaaggag
tactggtttgtgctgacggccgagaatctgtcctggtataaggatgacgaggagaaagag
aagaaatacatgctttccgtggacaacctgaagctacgggatgtggagaaaggtttcatg
tcgagcaagcacatctttgccctctttaacactgagcagaggaatgtctacaaggattat
cggcagctggaactggcctgtgagacacaggaggaggtggacagctggaaggcctccttc
ctgagggctggcgtgtatccggagcgcgttggggacaaggagaaagccagcgagactgag
gagaatggttcggacaacttcatgcactccatggacccacagctagagcggcaggtggag
accatccggaacctggtagactcgtacatggccatcgttaacaagaccgtgagggacctc
atgccgaagaccatcatgcatctcatgatcaacaatacgaaggaattcatcttctcggag
ctgctggccaacctgtactcgtgcggggaccagaacacactgatggaggagtcggcggag
caggcacagcggcgcgacgagatgctgcgcatgtaccacgcactgaaggaggcgctcagc
atcatcggcgacatcaacacgaccactgtcagcacgcccatgcccccgcctgtggacgac
tcctggctgcaggtgcagagcgtaccggccggacgcaggtcacccacgtccagccccact
ccgcagcgccgagcccccgccgtgcccccagcccggcccgggtcgcggggccctgctcct
gggcctccgcctgctgggtccgccctggggggggcgccccccgtgccctccaggccgggg
gcttcccctgaccccttcggtcctcccccccaggtgccctcgcgccccaaccgcgccccg
cccggggtccccagcaggaagggcccagcctcacctacgcgacctgtggtcccccgacca
gctgaggctcccctcttagacttataa

DBGET integrated database retrieval system