KEGG   Felis catus (domestic cat): 101091150Help
Entry
101091150         CDS       T02385                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101091150 (MINPP1)
   00562 Inositol phosphate metabolism
    101091150 (MINPP1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101091150 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101091150 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 101091150
NCBI-ProteinID: XP_023096095
Ensembl: ENSFCAG00000032012
Position
D2
AA seq 487 aa AA seqDB search
MLRGPPRLLKVSVAPVAALAVALLSSLSRCSLLEPDDPAASALSPYFGTKTRYEDANPGL
LPDPEAPRRDPELLEDACTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARPSGDGRAG
PAGGRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSLENYGRLQLV
TSSKHRCVDSGAAFLQGLWEHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNNLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAIEQKQRSQPV
SSPVVLQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLMFVLY
HCKNAKTPKEEFRVQMLLNEKVLPLAHSQETASLYEDLKEHYRDLLQSCRASDECELPKV
NNTSDEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtggccccccgcgcctcctcaaggtctccgtggcaccggtcgcggccctggct
gtggcgctgctctcgtcgctctcacgctgctccctcctggagccggacgaccccgcggcc
tccgcgctcagcccctacttcggcaccaagacccgctacgaggatgccaaccccgggctg
ctgccggaccccgaggcgccgcggagggaccccgagctgctggaggacgcctgcacgccg
gtgcagctggtcgccctcatccgccacggcacccgctaccccacggccaagcagatccgc
aaactgcggcagctgcacggcctgctgcaggcccgcccgtccggcgacggccgcgctggc
cccgccggcggccgcgacctgggcgccgcgctggccgactggccgctgtggtacgcggac
tggatggacgggcagctggtggagaaggggcggcaggacatgcgacagctggcgctgcgc
ctggcctccctcttcccggccctgttcagcctcgagaactacggccgcctgcagctggtc
accagctccaaacaccgctgcgtggacagcggcgccgccttcctgcaggggctgtgggag
cactaccaccccggcttgccgccgcccgacgtcgcagatatggagtgtggacctccaaga
attaatgataaactaatgaggttcttcgatcactgtgagaagtttttaactgaagtggaa
aagaatgccacggcactttatcatgtagaagccttcaaaacgggaccagaaatgcagaac
attttaaaaaaggtcgcagctactttgcaagtgccagtcaacaatttaaatgcagattta
attcaggtagctttttttacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggtattagaatatttaaatgatctgaag
caatattggaaaagaggatacgggtacactattaatagtcggtccagctgcaccctgttt
caggatatcttccaacacttggacaaagcaattgaacagaaacaaaggtctcagccggtt
tcctctccagtcgtcctgcagtttggtcacgcggagacccttcttccactgctctccctc
atgggctacttcaaagacaaggagcccctgacggcttacaactataaggaacagatgcat
cggaagttccgaagtggccacattgtgccctatgcctcgaacctcatgtttgtgctttac
cattgtaagaatgcgaagactcccaaagaagagttccgggtgcagatgctattgaatgaa
aaggtgttgccattggctcactcccaggaaactgcttccctatatgaggatctcaaggag
cactacagggacctcctccagagctgtcgcgccagtgacgagtgtgaattaccaaaggtg
aacaacacgtctgatgagctatga

DBGET integrated database retrieval system