KEGG   Felis catus (domestic cat): 101091319Help
Entry
101091319         CDS       T02385                                 

Gene name
UBB
Definition
(RefSeq) polyubiquitin-B
  KO
K04551  ubiquitin B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04144  Endocytosis
fca05012  Parkinson disease
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101091319 (UBB)
   04137 Mitophagy - animal
    101091319 (UBB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101091319 (UBB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101091319 (UBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101091319 (UBB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101091319 (UBB)
Ubiquitin system [BR:fca04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   101091319 (UBB)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101091319 (UBB)
  Exosomal proteins of other body fluids (saliva and urine)
   101091319 (UBB)
  Exosomal proteins of colorectal cancer cells
   101091319 (UBB)
  Exosomal proteins of bladder cancer cells
   101091319 (UBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 101091319
NCBI-ProteinID: XP_003996358
Position
E1
AA seq 305 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGC
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcttcgtgaagaccctgactggcaagaccatcaccctggaggtggagcccagt
gacaccatcgaaaatgtgaaggctaagatccaggataaggagggcatccccccagaccag
cagaggctcatctttgcaggcaagcagctggaagatggccgcactctttctgattacaac
atccagaaagagtcgaccctgcacctggtcctgcgtctgaggggcggtatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccatcgaa
aatgtgaaggccaagatccaagataaagagggcatccctcctgaccagcagaggctcatc
tttgcaggcaagcagctggaagatggccgcactctttctgattacaacatccagaaagag
tcgaccctgcacctggtcctgcgtctgaggggtggtatgcagatcttcgtgaagaccctg
accggcaagaccatcaccctggaggtggagcccagtgacaccatcgaaaatgtgaaggcc
aagatccaggataaggagggcatccccccagaccagcagaggctcatctttgcaggcaag
cagctggaagatggccgcactctttctgattacaacatccagaaagagtcgaccctgcac
ctggtcctgcgtctgaggggtggtatgcagatcttcgtgaagaccctgaccggcaagacc
atcaccctggaggtggagcccagtgacaccatcgaaaatgtgaaggccaagatccaagat
aaagaaggcatccctcctgaccagcagaggctcatctttgcgggcaagcagctggaagat
ggccgcactctttctgattacaacatccagaaagagtccactctccatctggttcttcgt
ctgaggggtggctgttaa

DBGET integrated database retrieval system