KEGG   Felis catus (domestic cat): 101091455Help
Entry
101091455         CDS       T02385                                 

Gene name
EIF2S1
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit 1
  KO
K03237  translation initiation factor 2 subunit 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca03013  RNA transport
fca04140  Autophagy - animal
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101091455 (EIF2S1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101091455 (EIF2S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101091455 (EIF2S1)
  09143 Cell growth and death
   04210 Apoptosis
    101091455 (EIF2S1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101091455 (EIF2S1)
  09172 Infectious disease: viral
   05162 Measles
    101091455 (EIF2S1)
   05164 Influenza A
    101091455 (EIF2S1)
   05160 Hepatitis C
    101091455 (EIF2S1)
   05168 Herpes simplex virus 1 infection
    101091455 (EIF2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:fca03012]
    101091455 (EIF2S1)
Translation factors [BR:fca03012]
 Eukaryotic Type
  Initiation factors
   eIF-2
    101091455 (EIF2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1 SoDot-IcmSS DUF4446 DUF4453
Motif
Other DBs
NCBI-GeneID: 101091455
NCBI-ProteinID: XP_011281592
Ensembl: ENSFCAG00000031891
UniProt: M3WYU5
Position
B3
AA seq 315 aa AA seqDB search
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDERGVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaacgtaaggtccattgctgaaatgggggcttatgtcagcttgctggaatacaac
aatattgaaggcatgattcttcttagtgagttgtccagaaggcgtatccgttctataaac
aaactcatcagaattggcaggaatgaatgtgtggtagtcattagagtggacaaagaaaaa
ggatatattgatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaagat
aaattcaccaaatccaaaactgtttacagtattcttcgtcatgttgctgaggtgttagag
tacaccaaggacgagcagctggagagcctgttccagaggactgcctgggtctttgatgac
aaatacaagagacccggatacggtgcctatgatgcatttaagcatgcagtctcagaccca
tctattttggatagtttagatttgaatgaagatgaacggggagtacttattaacaatatt
aataggcgtttgacaccacaagctgtcaaaattcgagcagatattgaagtggcttgttat
ggttatgaaggcattgatgctgtaaaagaagccctgagagcaggtttgaattgttctaca
gaaaccatgcccatcaagattaatctaatagctcctcctagatatgtgatgacaacaaca
accctggagagaacagaaggcctctctgtcctcaatcaagctatggctgttataaaagaa
aagattgaggaaaagaggggtgtcttcaatgtccaaatggagcctaaagtggtcacagat
acagatgagaccgaacttgcaaggcagcttgagaggcttgagagagagaatgcagaagtg
gatggagacgatgatgcagaagaaatggaagccaaagccgaagattaa

DBGET integrated database retrieval system