KEGG   Felis catus (domestic cat): 101091492Help
Entry
101091492         CDS       T02385                                 

Gene name
ATP2A1
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform X2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101091492 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    101091492 (ATP2A1)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101091492 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091492 (ATP2A1)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     101091492 (ATP2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 101091492
NCBI-ProteinID: XP_003998782
Ensembl: ENSFCAG00000007746
UniProt: A0A2I2V2N1
Position
E3
AA seq 993 aa AA seqDB search
MEAAHSKTTEECLAYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKTVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVSTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWLRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDKVDGNICVLNEFSITGSTYAPEGEVLKNDKPVRSGQYDGLVELATICALC
NDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFSTDVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPITGPV
KDKILSVIKEWGTGRDTLRCLALATRDTPPKREEMILDDSARFMEYETDLTFVGVVGMLD
PPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDL
PLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIG
GYVGAATVGAAAWWFLYADDGPHVTYSQLTHFMKCNEENPDFEGLDCEVFEAPQPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRA
LDCTQWLMVLKISFPVILLDELLKFIARNYLEG
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgcacactccaagaccacagaagaatgtctggcctattttggggtgagcgag
actacaggcctgacgccggaccaagtgaagcggcacctagagaaatacggccccaatgag
ctccctgctgaggaagggaagtccctgtgggagttggtgatagagcagtttgaagacctc
ctggtgcggatccttctcctggccgcctgcatttccttcgtgctggcctggttcgaggaa
ggtgaagaaaccatcactgcctttgttgaaccctttgtcatcctcttgatcctcattgcc
aatgccatcgtgggggtttggcaggagcgtaatgcagagaatgccattgaggctctgaag
gaatatgaacccgagatggggaaagtctaccgggctgaccgcaagacagtccagaggatc
aaggctcgggacattgtccccggggacattgtggaggtggctgtgggcgacaaagtgcct
gcagatatccggatcctgtccatcaaatccaccaccctccgggttgaccagtccatcctg
acgggcgagtccgtatctgtcatcaagcacacagaccctgttcctgacccccgagctgtc
aaccaggataagaagaacatgcttttctcgggtaccaacatcgcagctggcaaggcctta
ggcatcgtggccactactggtgtgagcactgagattgggaagatccgtgaccagatggcc
gccacggaacaggacaaaacccctctgcagcagaagctggatgagtttggggagcagctc
tccaaggtcatctccctcatctgtgtggccgtctggctcatcaacatcggccatttcaac
gatcccgtccacggcggctcctggttgcggggtgccatctactactttaagattgccgtg
gccctggctgtggccgcgatcccagaaggccttcctgcggtcatcaccacctgcctggcc
ttgggcacccggcggatggcaaagaaaaatgcaatcgtgaggagcctgccctccgtggag
actctgggctgcacctccgtcatctgttccgacaagacgggcaccctcaccaccaaccag
atgtctgtctgcaagatgtttattatcgacaaggtggacggaaacatctgtgtcctgaac
gagttctccatcactggttccacttacgctccagaaggagaggtcttgaagaatgataag
ccagtccgctcagggcagtatgatgggctggtggagttggccaccatttgtgccctctgc
aatgactcctccttggacttcaacgaggccaaaggtgtttacgagaaggtgggtgaggca
acagagacggcgctcaccaccctggtggagaagatgaatgtgttcagcacagacgtgagg
agcctctcgaaagtggagcgggccaacgcctgcaactcagtgatccgccagctgatgaag
aaggaatttaccctggagttctcccgagaccggaagtccatgtctgtctattgctccccg
gccaaatcccgggctgccgtgggcaacaagatgtttgtcaagggtgcccctgagggggtc
atcgaccgctgtaactacgtgcgagttggcaccacccgcgtgccgattacagggccggtg
aaggacaagatcctgtccgtgatcaaggagtggggcaccggccgggataccctgcgctgc
ctggccctggccacccgggacacccccccgaagcgagaggagatgatcctggatgactct
gccaggttcatggagtacgagacggacctgacatttgtcggcgtggtgggcatgctggac
ccaccccgcaaggaggtcacgggctctattcagctgtgccgggatgccggaatccgagtc
atcatgatcaccggggacaacaagggcacagccattgccatctgccgacgaatcggcatc
tttggggagaacgaggaggtggccgaccgagcctacaccggccgggagtttgacgacctg
cccctggcggaacagcgggaggcctgccgtcgcgcctgctgcttcgcccgtgtggagccc
tcccataagtcgaagatcgtggagtatctgcagtcctacgatgagatcacggccatgacg
ggtgatggtgtcaacgatgcccctgccctgaagaaggccgagatcggcatcgccatggga
tccggcaccgccgtggccaagaccgcttccgagatggtgctggccgacgacaacttctcc
accatcgtggctgcggtggaggagggccgcgccatttacaacaacatgaagcagttcatc
cgctacctcatctcctccaacgtgggcgaggtggtctgcatcttcctgaccgccgcctta
ggactgcctgaggccctgatccctgtgcagctgctgtgggtgaacttggtgactgacggg
ctcccggccacagccctgggcttcaacccaccagacctggacatcatggaccggcctccc
cggagccccaaggagcccctcatcagtggctggctcttcttccgctacatggcaatcggg
ggctacgtgggtgcggccactgtgggagcggctgcctggtggttcctgtatgcagatgac
gggcctcatgtcacttacagccagctgactcacttcatgaagtgcaacgaggaaaacccc
gactttgagggcctggactgcgaggtctttgaggccccccagcccatgaccatggccttg
tccgtgctggttaccattgaaatgtgcaacgctctcaacagcctgtctgagaaccagtcc
cttctgcggatgccgccctgggtgaacatctggctgctgggctccatctgcctgtccatg
tccctgcacttcctcatcctctatgtcgatcctctgccgatgatcttcaagctccgggcc
ctggactgcacccagtggctcatggtcctcaagatctcatttccagtcatcctgctcgat
gagctcctcaagttcattgctcggaactacctagagggataa

KEGG   Felis catus (domestic cat): 101101678Help
Entry
101101678         CDS       T02385                                 

Gene name
ATP2A3
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 3 isoform X1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101101678 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    101101678 (ATP2A3)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101101678 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101678 (ATP2A3)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     101101678 (ATP2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD DUF3106
Motif
Other DBs
NCBI-GeneID: 101101678
NCBI-ProteinID: XP_011287355
Ensembl: ENSFCAG00000007932
UniProt: M3W8N4
Position
E1
AA seq 999 aa AA seqDB search
MEAAHLLSAADVLRRFSVTVEGGLRPEQVTSARERYGPNELPTEEGKSLWELVLEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRVRARDIVPGDIVEVAVGDKVPADLRLLEIKSTTLRVDQSIL
TGESVSVTKHTDAILDPRAVNQDKKNMLFSGTNIASGKALGVAVATGLHTELGKIRSQMA
AVEPERTPLQHKLDEFGRQLSRAISVICVAVWVINISHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEAEASSCRLHEFTISGTTYAPEGEVRQAEQLVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTNLQALSRVERASACNAVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRPGLAAQGSKMFVKGAPESVIERCSSVRVGSRTVPLNAT
SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMQLDDCGKFAQYEMDLTFVGCVGML
DPPRPEVAACIARCHQAGIRVVMITGDNKGTAVAICRRLGIFKDSEDVVGKAYTGREFDD
LSPEQQRQACRTACCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREALISGWLFFRYLAI
GVYVGLATVAAATWWFLYDAEGPHVTFYQLRNFLKCSEDNPLFADIDCEVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLAAVAMSMALHFLILLVPPLPLIFQVT
PLSGRQWVVVLQISLPVILLDEALKYLSRNHVDEEKDKK
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcgcacctactctcggcagccgacgtgctgcgccgcttctcggtgacggtc
gagggcggcctgaggccagagcaggtgactagcgcgcgagagcgctacggccccaacgag
ctcccaactgaagaagggaagtccctgtgggagctggtgctggagcagtttgaagacctc
ctggtgcgcatcctgctgttggctgccctggtctccttcgtcctggcctggtttgaggag
ggtgaggagaccacaacagccttcgtggaacctctggtcatcatgctgatcctcgtggcc
aatgccatcgtgggcgtatggcaggaacgcaatgctgagagtgccattgaggccctgaaa
gagtatgagcctgagatgggtaaggtgatccgctcggaccgcaagggcgtgcagagggtc
cgcgcccgggacatcgtccctggagacatcgtggaagtagcagtgggagacaaagtgccc
gctgacctccgcctcctcgagatcaagtccaccactctgagagtggaccagtccatcctg
acaggtgaatccgtgtctgtgaccaaacacacagatgctatcctggatcccagagctgtg
aaccaggacaagaagaacatgctattctctggtaccaacattgcatcaggcaaggcactg
ggggtggcagtggccacaggcctgcacacagagctgggtaagatccggagtcagatggcg
gcagtggagccagagcggacaccgctgcagcacaagctggatgagttcgggcggcagctg
tcccgtgccatctctgtgatctgtgtggccgtgtgggtcatcaacatcagccacttcgct
gacccagcccatggtggctcctggcttcgtggtgccgtctactacttcaagattgccgtg
gctctggctgtggctgccatccctgagggcctcccagctgttatcactacatgcctggct
ctgggcacacggcgcatggcacgcaagaatgccattgtgcggagtctgccctctgtggag
acgctgggctgcacctcggtcatctgctccgacaagacaggcacactcaccaccaatcag
atgtctgtctgccggatgttcgtggtagccgaagctgaagcaagctcctgccgtttgcac
gagttcaccatctccggcaccacttacgccccggagggcgaagtgaggcaggcggagcag
ctcgtgcgctgtgggcagttcgatgggctggtggagctggcgacaatctgtgccctgtgc
aacgactcagcgctggactacaatgaggctaagggcgtatatgagaaggtgggagaggcc
acggagacagccctgacttgcctggtggagaaaatgaatgtgtttgacaccaacctccag
gccctgtcccgagtggaacgagccagtgcctgcaatgcggtcatcaagcagctgatgcgg
aaggagtttactttggagttctcccgggaccggaagtccatgtcagtgtactgcacgccc
actcgccctggcctggcagcccagggcagcaagatgtttgtgaagggggctcctgagagt
gtgatcgagcgctgcagctcagtccgagtgggaagccgcacagtacccctgaacgccacc
tccagggagcagatcctcgccaagatccgggattggggctccggctcagacacactgcgt
tgcctggcactggccactcgggatgcacccccaaggaaggaggacatgcagctggatgac
tgcggcaaatttgcgcagtacgagatggacctgacttttgtgggctgcgtgggcatgctg
gaccctccaaggcccgaggtggctgcttgcatcgcacgctgccaccaggccggcatccgt
gtggtcatgatcacaggggacaacaaaggcacagctgtggccatctgccgccggcttggc
atcttcaaggactcagaggatgtggtgggcaaggcctacacgggtcgcgaattcgatgac
ctcagccctgagcagcaacgccaggcctgccgcacagcgtgctgcttcgcccgtgtggaa
cctgcacacaagtcccgaattgtagagaacctacagtccttcaatgagatcaccgccatg
actggagacggggtgaatgatgccccggctctgaagaaagcagagattggcattgccatg
ggctccggcacagctgtggccaagtcggcagctgagatggtgctgtcagatgacaacttt
gcctcaattgtggctgcagtggaggagggccgggccatctacaacaacatgaagcaattc
atccgctacctcatctcctccaatgtcggcgaggttgtctgcatcttcctcacggcaatt
ctgggcctgccggaagccctgatccctgtgcagctgctctgggtgaacctggtgacggat
ggcttacctgccacagccctgggtttcaacccaccagacctggacatcatggagaagctg
ccccggaaccctcgtgaggccctcatcagtggctggctcttttttcgatatctggctatt
ggagtgtacgtaggcctggccacggtggctgccgccacctggtggttcctatatgatgcc
gagggacctcacgtcaccttctaccagctgaggaacttcctgaagtgctccgaggacaac
ccactctttgctgacattgactgcgaggtcttcgagtcacgcttccccacaaccatggcc
ttgtctgtgctggtgaccattgaaatgtgcaatgccctcaacagtgtctcggagaaccag
tcgctgctgcggatgccaccctggctgaacccttggctgctggcagctgtggccatgtcc
atggccctgcacttcctcatcctgctggtgccacccctgccccttattttccaggtgacc
ccactgagtgggcgccagtgggtagtggtgctccagatatctctgcctgtcatcctgctt
gatgaggccctcaagtacctgtcccggaaccacgtggatgaagaaaaggacaagaagtga

KEGG   Felis catus (domestic cat): 493691Help
Entry
493691            CDS       T02385                                 

Gene name
ATP2A2
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04972  Pancreatic secretion
fca05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    493691 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    493691 (ATP2A2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    493691 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    493691 (ATP2A2)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     493691 (ATP2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 493691
NCBI-ProteinID: NP_001009216
Ensembl: ENSFCAG00000028178
UniProt: Q00779
Position
D3
AA seq 997 aa AA seqDB search
MENAHTKTVEEVLGYFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDKVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVKCHQYDGLVELATICALC
NDSALDYNEAKGVYKKFGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGV
KQKVMSVIREWGSGSDTLRCLALATHDNPLRREEMNLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
SPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKDDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNLTQWLMVLKISLPVILMDETLKFVARNYLEPAILE
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcgcacacaaagacggtggaggaggtgctgggctacttcggcgtcaacgag
agcacagggctgagcctggagcaggtcaagaagctcaaggagagatggggctccaacgag
ttaccggctgaagaaggaaaaaccttgttggaacttgtgattgagcagtttgaagactta
ttagttagaattttattgctggcagcttgtatatcttttgttttggcttggtttgaagaa
ggtgaagaaacaattacagcctttgtagaaccctttgtaattttacttatattagtagcc
aatgctattgtgggtgtatggcaggaaagaaatgctgagaatgctattgaagcccttaag
gaatatgagcctgaaatgggcaaagtgtatcgacaggacagaaagagtgtacagcggatt
aaagctaaggacatagttcctggcgatattgtagaaattgctgttggtgacaaagttcct
gctgatataagattaacttccatcaaatctactactctgagagttgaccagtccattctc
acaggtgagtctgtgtctgtcatcaagcacactgaccctgtcccagacccacgggccgtc
aaccaagataagaagaacatgctgttttctggaacaaacattgctgctggcaaagccatg
ggagtggtggtggcaactggagttaacacagaaatcggcaagatccgggatgagatggtg
gcaacagaacaggagagaacacccctccagcagaaactagacgagtttggggagcagctt
tccaaagtcatatcccttatttgcattgcagtctggatcataaacattgggcacttcaat
gacccagttcacggaggctcctggatcaggggtgctatttactactttaaaattgcggtg
gccctggctgtggcggccattcctgaaggtctgcctgctgtcatcaccacctgcctggct
cttggaactcgcagaatggcaaagaaaaatgccattgttcgaagtctcccttctgtggaa
acccttggttgtacttctgttatctgctcagacaagactggtacgcttacgacgaaccag
atgtcagtgtgcaggatgttcattctggacaaggttgagggggatacttgttcccttaat
gagtttaccataactgggtcaacatatgcacctattggagaagtgcataaagatgataaa
ccagtgaaatgtcatcaatatgatggtcttgtggaattggcaacaatttgtgctctttgt
aatgattctgcattggattacaatgaggcgaagggcgtgtataaaaagtttggggaagct
acagagactgctctcacttgcctagtagagaagatgaatgtatttgataccgaattgaag
ggtctttctaaaatagaaagagcaaatgcctgcaactcggtcataaagcagttaatgaaa
aaagaatttactctcgagttttcacgcgatagaaaatcaatgtcagtttattgtacacca
aacaaaccaagccggacatcgatgagcaaaatgtttgtgaagggcgctcccgaaggtgtc
attgacaggtgcacccacattcgggttggaagtaccaaagtccctatgacccctggagtc
aaacagaaggtcatgtctgtcatcagggaatggggtagtggcagcgacacactgcggtgc
ctggctctggccactcatgacaacccactgagaagagaagaaatgaaccttgaggactct
gccaactttatcaaatatgagactaatctgactttcgttggctgtgtgggcatgctggac
cctccaagaattgaagtggcctcttctgtgaagctttgccggcaagcaggcatccgggtg
atcatgatcacaggggacaacaaaggcactgctgtggccatctgtcgccgcattggcatc
tttgggcaggacgaggatgtgacgtcaaaggcttttacgggtcgggagtttgatgagctc
agtccttcagcccagagagatgcctgcttgaatgcccgctgttttgctcgagttgagcct
tcccacaagtcaaaaattgtagagtttcttcagtcttttgatgagattacagctatgacc
ggggatggcgtgaatgatgctcccgccctgaagaaatctgagattggcattgccatgggc
tctggcacggcagtggctaaaaccgcctctgagatggtcctggccgacgacaacttctcc
accattgtggctgctgttgaggaggggcgggcgatttacaacaatatgaagcagtttatc
cgctacctcatctcttcgaatgtgggggaagttgtctgtattttcctgactgcagccctt
ggatttcctgaggctttaattcctgtccagctgctctgggtcaatctggtgacagacggc
ctgcctgccaccgcactggggtttaacccacctgatctggacatcatgaacaaaccaccc
cggaacccgaaggaaccactgatcagcggatggctctttttccgttacctagctattggc
tgttacgttggcgctgctactgtgggtgctgccgcgtggtggtttattgctgccgacggg
ggtccaagggtgtccttctaccaactgagccacttcctacagtgtaaagatgacaacccg
gactttgaaggagtggattgtgcaatctttgagtccccgtacccgatgacaatggcgctg
tctgttctagtaaccatagagatgtgtaacgccctcaacagcttgtctgaaaaccagtct
ctgctgaggatgcccccttgggagaacatctggctcgtgggctccatctgcctgtccatg
tcgctccatttcctcatcctctacgtggaacctttgccacttattttccagatcacaccg
ctgaacttgacccagtggctgatggtgctgaaaatctccttgcctgtgattctaatggat
gagacactcaagtttgtggcccgcaactacctggaacctgcaatactggagtaa

DBGET integrated database retrieval system