KEGG   Felis catus (domestic cat): 101091536Help
Entry
101091536         CDS       T02385                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04015  Rap1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04714  Thermogenesis
fca04722  Neurotrophin signaling pathway
fca04723  Retrograde endocannabinoid signaling
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05132  Salmonella infection
fca05133  Pertussis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101091536 (MAPK13)
   04010 MAPK signaling pathway
    101091536 (MAPK13)
   04370 VEGF signaling pathway
    101091536 (MAPK13)
   04668 TNF signaling pathway
    101091536 (MAPK13)
   04068 FoxO signaling pathway
    101091536 (MAPK13)
   04071 Sphingolipid signaling pathway
    101091536 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101091536 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101091536 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101091536 (MAPK13)
   04620 Toll-like receptor signaling pathway
    101091536 (MAPK13)
   04621 NOD-like receptor signaling pathway
    101091536 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    101091536 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    101091536 (MAPK13)
   04660 T cell receptor signaling pathway
    101091536 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    101091536 (MAPK13)
   04659 Th17 cell differentiation
    101091536 (MAPK13)
   04657 IL-17 signaling pathway
    101091536 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    101091536 (MAPK13)
   04670 Leukocyte transendothelial migration
    101091536 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101091536 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    101091536 (MAPK13)
   04917 Prolactin signaling pathway
    101091536 (MAPK13)
   04926 Relaxin signaling pathway
    101091536 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101091536 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    101091536 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    101091536 (MAPK13)
   04722 Neurotrophin signaling pathway
    101091536 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101091536 (MAPK13)
  09158 Development
   04380 Osteoclast differentiation
    101091536 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    101091536 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101091536 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101091536 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101091536 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101091536 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101091536 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101091536 (MAPK13)
   05133 Pertussis
    101091536 (MAPK13)
   05152 Tuberculosis
    101091536 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101091536 (MAPK13)
   05161 Hepatitis B
    101091536 (MAPK13)
   05163 Human cytomegalovirus infection
    101091536 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101091536 (MAPK13)
   05169 Epstein-Barr virus infection
    101091536 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101091536 (MAPK13)
   05140 Leishmaniasis
    101091536 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    101091536 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101091536 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101091536 (MAPK13)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101091536 (MAPK13)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101091536 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 APH Kdo Kinase-like Haspin_kinase DUF4023
Motif
Other DBs
NCBI-GeneID: 101091536
NCBI-ProteinID: XP_023109677
Position
B2
AA seq 366 aa AA seqDB search
MSFTRKKGFCKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELRLLKHMQHENVIGLLDVFTPASSLRGFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLSQILKVTG
VPGAEFVQKLNDKAAKSYIQSLPQSPKKDFSQLFPRASPQATDLLEKMLELDVDKRLTAS
QALAHPFFEPFRDPEEETEAPQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
CGMKLQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcacccggaaaaagggcttctgcaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtcgccgacgcacgtaggcagcggggcctatggcgccgtgtgc
tccgccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtcggagatctttgccaagcgggcctaccgagagctgcgcctgctgaagcacatgcag
catgagaatgtcatcgggctcctggatgtcttcaccccagcctcctccctgcgcggcttc
catgacttctacctggtgatgcccttcatgcagacagacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtacctggtgtatcagatgctcaagggtcttaagtac
atccactcagctggggtcgtccacagggacctgaagccgggcaacctggccgtaaacgag
gactgtgagctgaagatcttggattttgggctggcccggcacgcagatgctgagatgacc
ggctatgtggtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcactac
aaccagactgtggacatctggtctgtgggctgtatcatggcagagatgctgaccgggaaa
actctgttcaaggggaaagattacctggaccagctgtcccagatcctgaaagtgaccggg
gtgccgggtgcagagtttgtgcagaagttgaatgacaaagcagccaaatcctacatccag
tccctgccacagagccccaagaaggatttctctcagctcttcccacgggccagcccccag
gccacagacctgctagagaagatgttggagctggacgtggacaagcgtctgacggcctcg
caggccctcgcccaccccttctttgaacccttccgagacccagaggaggagacagaggcc
ccgcagccatttgatgactccttagaacatgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
tgtggcatgaagctgcagtga

KEGG   Felis catus (domestic cat): 101101135Help
Entry
101101135         CDS       T02385                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04015  Rap1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04714  Thermogenesis
fca04722  Neurotrophin signaling pathway
fca04723  Retrograde endocannabinoid signaling
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05132  Salmonella infection
fca05133  Pertussis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101101135 (MAPK14)
   04010 MAPK signaling pathway
    101101135 (MAPK14)
   04370 VEGF signaling pathway
    101101135 (MAPK14)
   04668 TNF signaling pathway
    101101135 (MAPK14)
   04068 FoxO signaling pathway
    101101135 (MAPK14)
   04071 Sphingolipid signaling pathway
    101101135 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101101135 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101101135 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101101135 (MAPK14)
   04620 Toll-like receptor signaling pathway
    101101135 (MAPK14)
   04621 NOD-like receptor signaling pathway
    101101135 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    101101135 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    101101135 (MAPK14)
   04660 T cell receptor signaling pathway
    101101135 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    101101135 (MAPK14)
   04659 Th17 cell differentiation
    101101135 (MAPK14)
   04657 IL-17 signaling pathway
    101101135 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    101101135 (MAPK14)
   04670 Leukocyte transendothelial migration
    101101135 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101101135 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    101101135 (MAPK14)
   04917 Prolactin signaling pathway
    101101135 (MAPK14)
   04926 Relaxin signaling pathway
    101101135 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101101135 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    101101135 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    101101135 (MAPK14)
   04722 Neurotrophin signaling pathway
    101101135 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101101135 (MAPK14)
  09158 Development
   04380 Osteoclast differentiation
    101101135 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    101101135 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101101135 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101101135 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101101135 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101101135 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101101135 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101101135 (MAPK14)
   05133 Pertussis
    101101135 (MAPK14)
   05152 Tuberculosis
    101101135 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101101135 (MAPK14)
   05161 Hepatitis B
    101101135 (MAPK14)
   05163 Human cytomegalovirus infection
    101101135 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101101135 (MAPK14)
   05169 Epstein-Barr virus infection
    101101135 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101101135 (MAPK14)
   05140 Leishmaniasis
    101101135 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    101101135 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101101135 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101101135 (MAPK14)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101101135 (MAPK14)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101101135 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 101101135
NCBI-ProteinID: XP_003986110
Ensembl: ENSFCAG00000027782
UniProt: M3X6W3
Position
B2
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
ccggagcgttaccagaacctgtccccggtgggctccggtgcctatggctccgtgtgtgct
gcctttgacacaaaaactgggttacgtgtggcagtgaagaagctctccagaccgtttcag
tccatcattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggagcagatctgaacaacattgtgaaatgtcag
aagcttacggatgaccatgttcagttccttatctaccagattctccgaggtctcaagtat
atacattcagctgacataattcacagggacctgaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggattttggactggctcgacatacagatgatgaaatgaca
ggctatgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgatcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccgaaaatgaactttgcaaatgtatttattggtgccaatcccttg
gcggtggacttgctggagaagatgcttgtactggactcagacaagagaatcacagcggcc
caagcacttgcacacgcctactttgcccagtaccatgatcctgatgatgaaccagtggct
gatccttatgatcagtcctttgaaagcagggacctccttatagatgaatggaagagcctg
acctacgatgaagtcatcagctttgtgcccccaccccttgaccaagaagagatggaatcc
tga

KEGG   Felis catus (domestic cat): 105260786Help
Entry
105260786         CDS       T02385                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04015  Rap1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04714  Thermogenesis
fca04722  Neurotrophin signaling pathway
fca04723  Retrograde endocannabinoid signaling
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05132  Salmonella infection
fca05133  Pertussis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    105260786 (MAPK11)
   04010 MAPK signaling pathway
    105260786 (MAPK11)
   04370 VEGF signaling pathway
    105260786 (MAPK11)
   04668 TNF signaling pathway
    105260786 (MAPK11)
   04068 FoxO signaling pathway
    105260786 (MAPK11)
   04071 Sphingolipid signaling pathway
    105260786 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    105260786 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105260786 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105260786 (MAPK11)
   04620 Toll-like receptor signaling pathway
    105260786 (MAPK11)
   04621 NOD-like receptor signaling pathway
    105260786 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    105260786 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    105260786 (MAPK11)
   04660 T cell receptor signaling pathway
    105260786 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    105260786 (MAPK11)
   04659 Th17 cell differentiation
    105260786 (MAPK11)
   04657 IL-17 signaling pathway
    105260786 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    105260786 (MAPK11)
   04670 Leukocyte transendothelial migration
    105260786 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    105260786 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    105260786 (MAPK11)
   04917 Prolactin signaling pathway
    105260786 (MAPK11)
   04926 Relaxin signaling pathway
    105260786 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105260786 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    105260786 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    105260786 (MAPK11)
   04722 Neurotrophin signaling pathway
    105260786 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105260786 (MAPK11)
  09158 Development
   04380 Osteoclast differentiation
    105260786 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    105260786 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    105260786 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105260786 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    105260786 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105260786 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105260786 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105260786 (MAPK11)
   05133 Pertussis
    105260786 (MAPK11)
   05152 Tuberculosis
    105260786 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105260786 (MAPK11)
   05161 Hepatitis B
    105260786 (MAPK11)
   05163 Human cytomegalovirus infection
    105260786 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105260786 (MAPK11)
   05169 Epstein-Barr virus infection
    105260786 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105260786 (MAPK11)
   05140 Leishmaniasis
    105260786 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    105260786 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105260786 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    105260786 (MAPK11)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105260786 (MAPK11)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105260786 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Cas_CT1975 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 105260786
NCBI-ProteinID: XP_023113428
Position
B4
AA seq 364 aa AA seqDB search
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDTRLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFRGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPEPPQSPGSL
DIEQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcccgcgcgcaggcttctaccggcaggaactcaacaagacggtgtgggaggtg
cctcagcggctgcaggggctgcgcccggtgggctcgggcgcctacggctcggtctgctcg
gcctacgacacgcggctgcgccagaaggtggcagtgaagaagctgtcgcgacccttccag
tcgctgatccacgcgcggaggacctaccgcgagctgcggctgctcaaacacctgaagcac
gagaacgtcatcgggctgctggacgtgttcacgccggccacctccattgaggacttcagc
gaagtgtacctggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgtccagttcctggtttaccagctgctgcgcgggctcaagtac
atccactccgcggggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagcttaggatcctggactttgggctagcccgccaggctgatgaggagatgacc
ggctatgtggccacccgctggtaccgcgcgcctgagatcatgctcaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccagggaaag
gccctcttcccaggaaatgactacatcgaccagctgaagcgaatcatggaggtggtgggc
acgcccagccctgaggttctagcaaaaatatcatcggaacacgcccggacatacatccag
tccctgccccccatgccccagaaggacctcaggagcatcttccgtggagccaaccccctg
gctgtggatctcctgggaaggatgctggtgctggacagtgaccagagggtcagtgcggct
gaggccctggcccatgcctacttcagccagtaccacgaccccgacgatgagcccgaggct
gagccctatgatgaaagcgttgaggccaaggagcggaccgtggaggagtggaaggagctc
acctaccaggaggtcctcagcttcaagcccccagagccaccgcagtcacctggcagcctg
gatattgagcagtga

KEGG   Felis catus (domestic cat): 111556320Help
Entry
111556320         CDS       T02385                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04015  Rap1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04714  Thermogenesis
fca04722  Neurotrophin signaling pathway
fca04723  Retrograde endocannabinoid signaling
fca04728  Dopaminergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05132  Salmonella infection
fca05133  Pertussis
fca05140  Leishmaniasis
fca05142  Chagas disease (American trypanosomiasis)
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05205  Proteoglycans in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111556320 (MAPK12)
   04010 MAPK signaling pathway
    111556320 (MAPK12)
   04370 VEGF signaling pathway
    111556320 (MAPK12)
   04668 TNF signaling pathway
    111556320 (MAPK12)
   04068 FoxO signaling pathway
    111556320 (MAPK12)
   04071 Sphingolipid signaling pathway
    111556320 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111556320 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111556320 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111556320 (MAPK12)
   04620 Toll-like receptor signaling pathway
    111556320 (MAPK12)
   04621 NOD-like receptor signaling pathway
    111556320 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    111556320 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    111556320 (MAPK12)
   04660 T cell receptor signaling pathway
    111556320 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    111556320 (MAPK12)
   04659 Th17 cell differentiation
    111556320 (MAPK12)
   04657 IL-17 signaling pathway
    111556320 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    111556320 (MAPK12)
   04670 Leukocyte transendothelial migration
    111556320 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111556320 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    111556320 (MAPK12)
   04917 Prolactin signaling pathway
    111556320 (MAPK12)
   04926 Relaxin signaling pathway
    111556320 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111556320 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    111556320 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    111556320 (MAPK12)
   04722 Neurotrophin signaling pathway
    111556320 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111556320 (MAPK12)
  09158 Development
   04380 Osteoclast differentiation
    111556320 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    111556320 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111556320 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111556320 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    111556320 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111556320 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111556320 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111556320 (MAPK12)
   05133 Pertussis
    111556320 (MAPK12)
   05152 Tuberculosis
    111556320 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111556320 (MAPK12)
   05161 Hepatitis B
    111556320 (MAPK12)
   05163 Human cytomegalovirus infection
    111556320 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111556320 (MAPK12)
   05169 Epstein-Barr virus infection
    111556320 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111556320 (MAPK12)
   05140 Leishmaniasis
    111556320 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    111556320 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111556320 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    111556320 (MAPK12)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111556320 (MAPK12)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111556320 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 111556320
NCBI-ProteinID: XP_023113427
Position
B4
AA seq 367 aa AA seqDB search
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSAGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPDEFVQRLQSAEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAERRV
TAAEALTHPYFESLQDTEDEPKAQKYDESFDDVDRTLDEWKRVTYKEVLSFKPPRQLGTK
VSKETAL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctccccgccgcccgcccgcaagggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgtgggctccggcgcgtacggcgcc
gtgtgctcggccgtggacagccgcaccggtgccaaggtggccatcaagaagctgtaccgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagcttcgcctcctcaagcac
atgcgtcacgagaacgtcatcgggctgctggacgtgttcactcctgacgaaaccctggat
gatttcacagacttttacctggtgatgccgttcatgggcaccgacctgggcaaactcatg
aagcacgagaagctgagcgaggaccgaatccagttccttgtctaccagatgctgaagggg
ctaaagtacatccatgctgctggcatcatccacagggacctgaagcctggcaatctggca
gtgaatgaggactgtgagctgaagatcctggacttcggcttggccaggcaggccgacagc
gagatgactgggtacgtggtgacccggtggtaccgtgcacctgaggtcatcttgaattgg
atgcactacacccagacggtggacatctggtcagcgggctgcatcatggcagagatgatc
acagggaagacgctgttcaagggcagtgaccacctggaccagctgaaggagatcatgaag
gtgacagggactcctcccgatgaatttgtgcagaggctgcagagtgccgaggcgaagaac
tacatgaagggcctccccgagctggagaagaaggattttgcctccatcctgactaacgca
agtcctctggctgtgaacctcctggagaagatgctggtactggatgcagaacggcgggtg
actgcggccgaggcgctcacgcacccctacttcgagtcactgcaggacacggaggacgaa
cccaaggcccagaagtacgacgagtcctttgacgatgtggatcgcacgctggacgagtgg
aagcgtgtcacatataaggaagtgctcagcttcaagcctccccggcagctggggaccaag
gtgtccaaggagacagcgctgtga

DBGET integrated database retrieval system