KEGG   Felis catus (domestic cat): 101091694Help
Entry
101091694         CDS       T02385                                 

Gene name
SNCA
Definition
(RefSeq) alpha-synuclein
  KO
K04528  alpha-synuclein
Organism
fca  Felis catus (domestic cat)
Pathway
fca05010  Alzheimer disease
fca05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091694 (SNCA)
   05012 Parkinson disease
    101091694 (SNCA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101091694 (SNCA)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    101091694 (SNCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synuclein
Motif
Other DBs
NCBI-GeneID: 101091694
NCBI-ProteinID: XP_003985224
UniProt: A0A2I2U480
Position
B1
AA seq 140 aa AA seqDB search
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK
EQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGGPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggatgtattcatgaaaggactttcaaaggccaaggagggagtcgtggctgctgctgaa
aaaaccaaacagggtgtggcagaagccgcaggaaagacaaaagagggtgttctctatgta
ggctccaaaaccaaggaaggtgtggttcatggtgtgaccacagtggctgagaagaccaaa
gagcaagtgacaaatgttggtgaggcggtggtgacaggggtgacagcagttgcacaaaag
acagtggagggagcagggagcatcgcagctgccactggctttggcaaaaaggatcagttg
ggcaagaatgaagaaggaggcccacaggaaggaattctggaagatatgcctgttgatcct
gacaatgaggcatacgaaatgccttctgaggaagggtatcaagactatgaacccgaagca
taa

DBGET integrated database retrieval system