KEGG   Felis catus (domestic cat): 101091812Help
Entry
101091812         CDS       T02385                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X3
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04066  HIF-1 signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04350  TGF-beta signaling pathway
fca04371  Apelin signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04931  Insulin resistance
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05221  Acute myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101091812 (RPS6KB2)
   04350 TGF-beta signaling pathway
    101091812 (RPS6KB2)
   04371 Apelin signaling pathway
    101091812 (RPS6KB2)
   04066 HIF-1 signaling pathway
    101091812 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    101091812 (RPS6KB2)
   04152 AMPK signaling pathway
    101091812 (RPS6KB2)
   04150 mTOR signaling pathway
    101091812 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101091812 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101091812 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101091812 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    101091812 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    101091812 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101091812 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091812 (RPS6KB2)
   05205 Proteoglycans in cancer
    101091812 (RPS6KB2)
   05231 Choline metabolism in cancer
    101091812 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101091812 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101091812 (RPS6KB2)
   05212 Pancreatic cancer
    101091812 (RPS6KB2)
   05225 Hepatocellular carcinoma
    101091812 (RPS6KB2)
   05226 Gastric cancer
    101091812 (RPS6KB2)
   05221 Acute myeloid leukemia
    101091812 (RPS6KB2)
   05224 Breast cancer
    101091812 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101091812 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101091812 (RPS6KB2)
   05163 Human cytomegalovirus infection
    101091812 (RPS6KB2)
   05165 Human papillomavirus infection
    101091812 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101091812 (RPS6KB2)
   01522 Endocrine resistance
    101091812 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101091812 (RPS6KB2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101091812 (RPS6KB2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101091812 (RPS6KB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101091812
NCBI-ProteinID: XP_003993747
Ensembl: ENSFCAG00000003395
UniProt: M3W099
Position
D1
AA seq 481 aa AA seqDB search
MAAVFDLDLETEEGSEGEPEFSPSDVWPHGELRAAGLEPVGHCEEVELTETSVNLGPERI
GPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNI
LESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLAL
GHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILV
RSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLTLPPYLTPDARDLVKK
FLKRNPSQRMGGGPGDAADVQRHPFFRHINWDDLLARRVDPPFRPCLQSEEDVSQFDIHF
TRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSSKEGFSFQPKLRSPRRLNSSPRTPV
SPLKFSPFEGFQPSPGPLEPTESPLPPLLPPPPPPSSSAPLPIRPPSGTKKSKRGRGRPG
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgtttgacctggacctggagacggaggaaggcagcgagggcgagccagag
ttcagcccctcggacgtgtggccccatggcgagttgagggcggctggcctggagcctgtg
ggacactgcgaggaggtggagttaacggagaccagtgtgaacctgggccccgagcgcatc
gggccccactgctttgagctgctgcgtgtgctgggcaaggggggctatggcaaggtgttc
caagtgcgaaaggtgcagggcaccaatttgggaaaaatatatgccatgaaagtcctgagg
aaggccaaaattgtgcgcaacgccaaggacacagcacacacgcgggctgaacggaacatc
ctagagtcagtgaagcaccccttcattgtggaactggcctatgccttccagactggtggc
aaactctacctcatcctcgagtgcctcagtggcggtgagctcttcacgcatctggagcga
gagggcatcttcctggaagacacggcctgtttctacctggcagagatcacgctggccctg
ggccatctgcactcccaaggcatcatctaccgggacctcaaacctgagaacatcatgctc
agcagccagggccacatcaaactgacagactttggactctgcaaggagtcgatccatgag
ggcgccgtcacccacaccttctgtggcaccattgagtacatggcccctgagattctggtg
cgcagtggccacaaccgggcagtggactggtggagcctgggggccctgatgtacgacatg
ctcactggatcgccaccctttactgcggagaaccggaagaaaaccatggacaagatcatc
aaagggaagctgacgctgcccccctacctcaccccggatgcccgggacctcgtcaaaaag
tttctgaagcggaatcccagccaacggatgggtggcggcccaggagacgctgctgatgtg
cagagacaccccttcttccgacacattaattgggatgacctcctggctcgccgcgtagac
ccccctttcaggccctgtctgcagtcagaggaggacgtgagccagtttgacatccacttc
acacggcagacgccagtggacagtccagatgatacggccctcagtgagagcgccaaccag
gccttcctgggcttcacgtatgtggcaccctccgtcctggacagcagcaaggagggcttc
tccttccagcccaagctacgctcccccaggcgcctgaacagcagcccccggaccccggtc
agccccctgaaattctcaccctttgagggattccagcccagccctggcccattggagccc
acggagtcccctctgcctcctctcctgccaccaccaccgccaccctcgagctctgccccc
ctccccatccgacccccctcagggaccaagaagtctaagaggggccgtgggcgccctggg
cgctag

KEGG   Felis catus (domestic cat): 101092561Help
Entry
101092561         CDS       T02385                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04066  HIF-1 signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04350  TGF-beta signaling pathway
fca04371  Apelin signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04931  Insulin resistance
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05221  Acute myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101092561 (RPS6KB1)
   04350 TGF-beta signaling pathway
    101092561 (RPS6KB1)
   04371 Apelin signaling pathway
    101092561 (RPS6KB1)
   04066 HIF-1 signaling pathway
    101092561 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    101092561 (RPS6KB1)
   04152 AMPK signaling pathway
    101092561 (RPS6KB1)
   04150 mTOR signaling pathway
    101092561 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101092561 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101092561 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101092561 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    101092561 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    101092561 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101092561 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092561 (RPS6KB1)
   05205 Proteoglycans in cancer
    101092561 (RPS6KB1)
   05231 Choline metabolism in cancer
    101092561 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101092561 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101092561 (RPS6KB1)
   05212 Pancreatic cancer
    101092561 (RPS6KB1)
   05225 Hepatocellular carcinoma
    101092561 (RPS6KB1)
   05226 Gastric cancer
    101092561 (RPS6KB1)
   05221 Acute myeloid leukemia
    101092561 (RPS6KB1)
   05224 Breast cancer
    101092561 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101092561 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101092561 (RPS6KB1)
   05163 Human cytomegalovirus infection
    101092561 (RPS6KB1)
   05165 Human papillomavirus infection
    101092561 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101092561 (RPS6KB1)
   01522 Endocrine resistance
    101092561 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101092561 (RPS6KB1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101092561 (RPS6KB1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101092561 (RPS6KB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101092561
NCBI-ProteinID: XP_003996665
Ensembl: ENSFCAG00000023434
UniProt: M3X5V6
Position
E1
AA seq 525 aa AA seqDB search
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
VEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatttcggaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgtttcgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacggaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgctaaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaggaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggatgctggagaagttcaagctcatccattcttcaggcatattaattgggaagaactg
ctggctaggaaggtggaacccccttttaaacctctgttgcaatctgaggaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgttgctccatctgtacttgaa
agtgtgaaagaaaaattttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccgcgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatcctcagacacctgtggaatatccaatggaaacaagtgga
gtagagcagatggatgtgacgatgagtggggaagcttcagcaccacttcccatacgacag
ccgaactctgggccatacaaaaaacaagctttccccatgatctccaaacgaccagagcac
ctacgtatgaatctatga

DBGET integrated database retrieval system