KEGG   Felis catus (domestic cat): 101091955Help
Entry
101091955         CDS       T02385                                 

Gene name
TBK1
Definition
(RefSeq) serine/threonine-protein kinase TBK1 isoform X1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04137  Mitophagy - animal
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04657  IL-17 signaling pathway
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101091955 (TBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101091955 (TBK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101091955 (TBK1)
   04621 NOD-like receptor signaling pathway
    101091955 (TBK1)
   04622 RIG-I-like receptor signaling pathway
    101091955 (TBK1)
   04623 Cytosolic DNA-sensing pathway
    101091955 (TBK1)
   04657 IL-17 signaling pathway
    101091955 (TBK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101091955 (TBK1)
   05162 Measles
    101091955 (TBK1)
   05164 Influenza A
    101091955 (TBK1)
   05161 Hepatitis B
    101091955 (TBK1)
   05160 Hepatitis C
    101091955 (TBK1)
   05168 Herpes simplex virus 1 infection
    101091955 (TBK1)
   05163 Human cytomegalovirus infection
    101091955 (TBK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101091955 (TBK1)
   05169 Epstein-Barr virus infection
    101091955 (TBK1)
   05165 Human papillomavirus infection
    101091955 (TBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101091955 (TBK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101091955 (TBK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     101091955 (TBK1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101091955 (TBK1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    101091955 (TBK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD Pkinase_Tyr Pkinase_fungal Kinase-like DUF713 CEP63 ubiquitin
Motif
Other DBs
NCBI-GeneID: 101091955
NCBI-ProteinID: XP_023112960
Ensembl: ENSFCAG00000028816
Position
B4
AA seq 729 aa AA seqDB search
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPISCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRMIIHIFSLQQMTAHKIYIHSYNTATVFHELVYKQTKIISSNQELIYEGRRLV
IEPGRLAQHFPKTTEENPIFVVSREPLSTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACKIANTLLLYQELMRKGIRWLIELVKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIESRLSPGGLLADMWAHQE
GTHPKDRHVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYEAFLDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQ
KMFAASSGIKHTMTPIYPCSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacctctaatcatctgtggcttttgtctgatattttaggccaaggagctact
gcaaatgtctttcgtggaaggcataagaaaactggtgacttatttgctatcaaagtattt
aataacataagcttccttcgtccagtggatgttcaaatgagagaatttgaagtgttaaaa
aaactcaatcacaaaaatattgtcaaattatttgctattgaagaggagacaacaacaaga
cataaagtacttattatggaattttgtccatgcggaagtttatacactgttttagaagag
ccatctaatgcctatggactaccagagtctgaatttttaattgttttgcgagacgtggtg
ggtggaatgaaccatctacgagagaatggcatagtgcaccgtgatatcaagccaggaaac
atcatgcgtgttataggggaagatggacagtctgtgtacaaactcacagattttggtgca
gctagagaattagaagatgatgaacagtttgtttctttgtatggcacagaagaatatttg
catcctgatatgtatgagagagcagtgctaagaaaagatcatcagaagaaatacggagca
acagttgatctttggagcattggggtaacgttttaccatgcagctactggatcactgccg
ttcagaccatttgaagggccacgtaggaataaggaagtgatgtataaaataattactgga
aagccttctggtgcaatatctggagtacagaaagcagaaaatggacccatcgactggagt
ggagacatgcctatttcttgcagtctttctcggggtcttcaagttctacttacccctgtt
cttgcaaacatccttgaggcagatcaggaaaagtgttggggttttgaccagttttttgca
gaaactagtgatatacttcatcggatgataattcatattttttcactgcaacaaatgaca
gcccataagatttatattcatagctacaatactgctactgtatttcatgaactggtatat
aaacaaaccaaaattatttcttcaaatcaagaacttatatatgaaggacgacgtttagtt
atagaacctggaagactggcacagcattttcctaaaactactgaggaaaatcccatcttt
gtagtgagtcgggaacctctgagtaccataggattaatatatgagaaaatttcccttcct
aaagtacatccacgttacgatttagatggggatgctagcatggctaaggcaataacagga
gttgtatgttatgcttgtaaaattgccaataccttgctgctttatcaggaattaatgcga
aaggggatacgatggttgatagaattagttaaagatgattataatgaaactgttcacaaa
aagacagaagttgtgatcacactggatttctgcatcagaaacattgaaaaaactgtgaaa
gtatacgaaaagttgatgaagatcaacctagaagcagcagagttaggtgaaatttcagac
atacacaccaaattgttgagactttccagttctcagggaacgatagaaaccagtcttcag
gatatcgaaagcagattatctccaggtggattgttggcagacatgtgggcccatcaagaa
ggcactcatccaaaagatagacatgtagaaaaactacaagtcctgctaaattgcatcaca
gagatttactatcagttcaaaaaagacaaagcagaacgtagactagcttataatgaagaa
cagatccacaaatttgataagcaaaaactgtattaccatgcaacaaaagctatgacccat
tttacagacgaatgtgttaaaaaatatgaggcatttttggataagtcagaagaatggatg
agaaagatgcttcatcttaggaaacagttattatcactaactaatcagtgttttgatatt
gaagaagaagtgtcgaagtatcaagattatacaaatgagttacaagaaactttgcctcaa
aaaatgtttgcagcctccagtggaatcaaacataccatgaccccaatttatccatgttct
aatacattagtggaaatgactcttggtatgaagaaattaaaggaagagatggaaggagtg
gttaaagaacttgctgaaaataatcatattttagaaaggtttggctctttaaccatggat
ggcggccttcgcaatgttgactgtctttag

DBGET integrated database retrieval system