KEGG   Felis catus (domestic cat): 101092204Help
Entry
101092204         CDS       T02385                                 

Gene name
PRKAG3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04710  Circadian rhythm
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101092204 (PRKAG3)
   04068 FoxO signaling pathway
    101092204 (PRKAG3)
   04152 AMPK signaling pathway
    101092204 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101092204 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101092204 (PRKAG3)
   04922 Glucagon signaling pathway
    101092204 (PRKAG3)
   04920 Adipocytokine signaling pathway
    101092204 (PRKAG3)
   04921 Oxytocin signaling pathway
    101092204 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    101092204 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    101092204 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101092204 (PRKAG3)
   04714 Thermogenesis
    101092204 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101092204 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101092204 (PRKAG3)
   04931 Insulin resistance
    101092204 (PRKAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 101092204
NCBI-ProteinID: XP_019694243
Ensembl: ENSFCAG00000007064
UniProt: M3W710
Position
C1
AA seq 485 aa AA seqDB search
MEHALRRNPSWSSLGGPERQEMSCLEEGENTSWPSPAMTAGSERSHEKQGAKASRWTRQE
AVAEGELPGLGEDPQAKPPAEYAGLEATFPKATHLSQAAPLAKVGAPPTEWDIFPPNHEA
SAAGSSTDELELDIGFPATASWGYELGLVEERPALCPSPRALLPRLGWDDELQKPGAQIY
MHFMQEHTCYDAMATSSKLVIFDTTLEIKKAFFALVANGIRAAPLWDSKKQSFVGMLTIT
DFILVLHRYYRSPLVQIYEIEEHKIETWREIYLQGCFKPLVSISPSSSLFEAVYTLIKNR
IHRLPVLDPVSGAVLHILTHKRLLKFLHIFGSLLPQPSFLSRTIQDLGIGTFRDLAVVLD
TAPILTALDIFVDRRVSALPVVNEAGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALKQR
TLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLSPAGI
DALGA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgcactgcgccggaacccatcctggagcagccttgggggacctgagcgtcaa
gagatgagctgtctagaagaaggagagaacacttcatggccatcgccggccatgaccgca
ggctcagaaagaagccatgagaaacaaggggccaaggcctccaggtggacaaggcaggag
gctgtggcggaaggagagctgccgggtctgggggaagatccccaggccaagccacctgct
gagtacgccggactggaggccacgttccccaaggccacacacttgtcccaggccgctcct
ttggccaaagtgggcgccccaccaacagagtgggacatcttcccccctaaccacgaagcc
tcggccgctggctccagcacggatgagctggagctggacatagggttcccggccacagca
tcatgggggtatgagctcggcctggtggaagagaggcctgccctgtgcccatccccacgg
gccctgttacccaggctgggctgggacgacgaactgcagaagccgggggcccagatctac
atgcacttcatgcaggagcacacctgctacgacgccatggcaaccagttccaagctggtc
atcttcgacaccacgctggagatcaagaaggccttctttgccctagtggccaacggcatc
cgggcggcaccgctgtgggacagcaagaagcagagcttcgtggggatgctgaccatcaca
gacttcatcttggtgctgcatcgctattacaggtccccgctggtccagatctatgagatt
gaagaacataagattgagacctggagagagatctaccttcaaggctgcttcaagcctctg
gtctccatttctcccagcagcagcctgttcgaagccgtctacaccctcatcaagaaccgg
atccaccgtctgccggtcctggacccggtctcaggcgccgtgctccacatcctcacacac
aagcgactgctcaagttcctgcacatctttggctccctgctgccccagccctccttcctc
tcccgcaccatccaagacctgggcatcggcacattccgagacttggccgtggtgctggac
acggcgcccatcctgacggccctggacatctttgtggaccggcgcgtgtctgcgctgcct
gtggtcaacgaagctggacaagtcgtgggcctctactcccgcttcgatgtgattcacctg
gctgcccagcaaacctacaaccacctggacatgagtgtgggcgaagccctgaagcagagg
acactgtgtctggaaggagtcctttcctgccagccccatgagagcttgggggaagtcatc
gaccggattgcccgggagcaggtacaccggctggtgctagtggacgagacccagcatctc
ctgggcgtggtgtccctctccgacatccttcaggcactggtgctcagccctgctggcatc
gatgccctcggtgcctga

KEGG   Felis catus (domestic cat): 101092284Help
Entry
101092284         CDS       T02385                                 

Gene name
PRKAB2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2 isoform X2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04710  Circadian rhythm
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101092284 (PRKAB2)
   04068 FoxO signaling pathway
    101092284 (PRKAB2)
   04152 AMPK signaling pathway
    101092284 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101092284 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101092284 (PRKAB2)
   04922 Glucagon signaling pathway
    101092284 (PRKAB2)
   04920 Adipocytokine signaling pathway
    101092284 (PRKAB2)
   04921 Oxytocin signaling pathway
    101092284 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    101092284 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    101092284 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101092284 (PRKAB2)
   04714 Thermogenesis
    101092284 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101092284 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101092284 (PRKAB2)
   04931 Insulin resistance
    101092284 (PRKAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 101092284
NCBI-ProteinID: XP_019693292
Ensembl: ENSFCAG00000013039
Position
C1
AA seq 265 aa AA seqDB search
MGNTTSDRVAGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKHTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKIKKLRLREGHIARQCDGP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaccaccagcgaccgggtggctggggagcgccacggcgccaaggctgcacgc
tccgagggcgccggcggccatgcgccgggtaaggagcacaaaatcatggtggggagtacc
gacgatcccagcgtcttcagcctgccggactccaagctccctggggacaaagaatttgta
tcatggcaacaagatttggaggactccgtaaagcatacacagcaggcccggcccactgtt
atccgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagc
accaagattccactgattaagagccataatgactttgttgccatcttagacctccctgag
ggagagcaccagtacaagttttttgtggatggacaatgggttcatgatccgtcagagcct
gtggttaccagtcagcttggcacgattaacaatttgatccatgtcaagaaatctgacttt
gaggtgtttgatgctttaaagctagattcaatggaaagctcagagacatcttgtcgagac
ctttccagctctcccccagggccttatggtcaagaaatgtacgtgtttcgatctgaggag
agattcaaatccccacccatcctacctcctcaccttcttcaagttattcttaacaaggac
actaatatatcttgtgacccagccttgcttcccgagcccaaccatgttatgctgaaccat
ctctatgcattatccattaagataaagaaactaaggctcagagaaggtcatattgccaga
cagtgtgatggtccttag

KEGG   Felis catus (domestic cat): 101094051Help
Entry
101094051         CDS       T02385                                 

Gene name
PRKAB1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04710  Circadian rhythm
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101094051 (PRKAB1)
   04068 FoxO signaling pathway
    101094051 (PRKAB1)
   04152 AMPK signaling pathway
    101094051 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101094051 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101094051 (PRKAB1)
   04922 Glucagon signaling pathway
    101094051 (PRKAB1)
   04920 Adipocytokine signaling pathway
    101094051 (PRKAB1)
   04921 Oxytocin signaling pathway
    101094051 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    101094051 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    101094051 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101094051 (PRKAB1)
   04714 Thermogenesis
    101094051 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101094051 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094051 (PRKAB1)
   04931 Insulin resistance
    101094051 (PRKAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 101094051
NCBI-ProteinID: XP_003994762
Ensembl: ENSFCAG00000000923
UniProt: M3VVN1
Position
D3
AA seq 270 aa AA seqDB search
MGNTSSERAALERQGGHKTPRRDSSGGAKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacgagcagcgagcgggccgcgctggagcggcagggcggccacaagacgccg
cggagggacagctccgggggcgccaaggacggggacaggcccaagatcctgatggacagc
cccgaggacgccgacctcttccactccgaggaaatcaaggctccagagaaggaagaattc
ctggcttggcagcatgatctggaagtgaatgataaagcccctgcccaggctcggccaaca
gtatttcgatggacgggaggcggaaaggaagtttacttatccgggtccttcaacaactgg
agtaaacttcccctcacgagaagccacaataactttgtagccatcctggacctgcctgaa
ggggagcatcagtacaagttctttgtggatggtcagtggacacatgacccttctgagcca
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agctccccaccaggaccctaccatcaggaaccctatgtctcaaaaccagaagaacggttt
aaggcaccacccattctccctccacatctgctccaggtcatcctgaacaaggacacgggg
atttcttgtgatccagctttgctccccgagcccaaccacgtcatgttgaaccacctttat
gcactctctatcaaggatggagtgatggtgctcagcgcgacccaccggtacaagaaaaag
tatgtcaccaccttgctatacaagcccatatga

KEGG   Felis catus (domestic cat): 101094684Help
Entry
101094684         CDS       T02385                                 

Gene name
PRKAG1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04710  Circadian rhythm
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101094684 (PRKAG1)
   04068 FoxO signaling pathway
    101094684 (PRKAG1)
   04152 AMPK signaling pathway
    101094684 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101094684 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101094684 (PRKAG1)
   04922 Glucagon signaling pathway
    101094684 (PRKAG1)
   04920 Adipocytokine signaling pathway
    101094684 (PRKAG1)
   04921 Oxytocin signaling pathway
    101094684 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    101094684 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    101094684 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101094684 (PRKAG1)
   04714 Thermogenesis
    101094684 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101094684 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094684 (PRKAG1)
   04931 Insulin resistance
    101094684 (PRKAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS DRTGG Cbl_N3 DUF2497
Motif
Other DBs
NCBI-GeneID: 101094684
NCBI-ProteinID: XP_003988685
Ensembl: ENSFCAG00000000091
Position
B4
AA seq 330 aa AA seqDB search
METVASSDSSPALENEHSQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggagacggttgcttcttcagatagctccccagctctggaaaatgagcattctcaagag
accccagaatccaacaatagtgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagctccaaattggttgtatttgatacttccctgcaggtgaagaaagct
ttctttgctttggtgactaatggtgtacgggctgcccctttgtgggatagtaagaagcaa
agttttgtgggcatgctgaccatcaccgatttcatcaatatcctgcatcgctactataaa
tcagccttggtacagatctatgagctggaagaacacaagatagaaacttggagagaggtg
tacctacaggactccttcaaaccacttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcgaaacaagatccacaggctgccagttattgacccagaatca
ggcaacaccttgtacatccttacccacaagcgtatcctcaagttcctcaaactgtttatc
actgagttccccaagccagagttcatgtctaagtctctggaagagctacagattggcacc
tatgctaacattgctatggtccgcaccaccacccctgtctacgtggctctgggcatcttt
gtacaacaccgagtttcagcactgccagtagtagacgagaaagggcgtgtggtggacatc
tactccaagtttgatgttatcaatctggcagcagaaaagacctacaacaacttagatgtg
tctgtgacgaaagccctccaacatcgatcacattactttgagggtgtcctcaagtgttac
ctgcatgagactctggagaccatcatcaacaggctggtggaagcagaggttcaccgactt
gtagtggtagatgagaatgatgtggtcaaggggattgtatcactgtctgacatcctgcag
gccctggtgctcacaggaggagagaagccctga

KEGG   Felis catus (domestic cat): 101095885Help
Entry
101095885         CDS       T02385                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X3
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04710  Circadian rhythm
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101095885 (PRKAA1)
   04068 FoxO signaling pathway
    101095885 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    101095885 (PRKAA1)
   04152 AMPK signaling pathway
    101095885 (PRKAA1)
   04150 mTOR signaling pathway
    101095885 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101095885 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101095885 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101095885 (PRKAA1)
   04922 Glucagon signaling pathway
    101095885 (PRKAA1)
   04920 Adipocytokine signaling pathway
    101095885 (PRKAA1)
   04921 Oxytocin signaling pathway
    101095885 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    101095885 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    101095885 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101095885 (PRKAA1)
   04714 Thermogenesis
    101095885 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101095885 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    101095885 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101095885 (PRKAA1)
   04931 Insulin resistance
    101095885 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095885 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095885 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101095885 (PRKAA1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101095885 (PRKAA1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   101095885 (PRKAA1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101095885 (PRKAA1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101095885 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    101095885 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like Kdo FTA2 APH Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 101095885
NCBI-ProteinID: XP_011284704
Ensembl: ENSFCAG00000023817
Position
A1
AA seq 535 aa AA seqDB search
MNPSIGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPS
DIFMVMEYVSGGELFDYICKNGRKSDVPGVVRTGSMKELDEKESRRLFQQILSGVDYCHR
HMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAG
PEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVD
PMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLY
NRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETP
RARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYL
RVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSC
QRNDSDADAQGKSSEASLTSSVTSLDSSVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctccattggcaaacatgaattgactgggcacaaagttgctgtgaagatactc
aatcgacagaagattcgaagccttgatgtggtaggaaaaatccgcagagaaattcagaac
ctcaagcttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatct
gatattttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaa
aatggaaggaaatctgatgtacctggagtagtaagaacaggctccatgaaggagctggat
gaaaaagaaagtcggcgtctgttccaacagatcctttctggtgtggattactgtcacagg
catatggtggtccatagagatttgaaacctgaaaatgtcctgcttgatgcacacatgaat
gcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaatttttaagaaca
agctgtggctcacccaactacgctgcaccagaagtaatttcaggaagattgtatgcaggt
ccagaggtagacatatggagcagtggggttattctctatgctttattatgtggaaccctt
ccgtttgatgatgatcatgtgccaactctttttaagaagatatgtgatgggatcttttat
acccctcagtatttaaatccatctgtgattagccttttgaaacatatgctacaggtggat
cccatgaagagggccacaatcaaagatatcagggagcatgaatggtttaaacaagatctt
ccaaaatatctctttcctgaggatccatcatatagttcaaccatgattgatgatgaagcc
ttaaaagaagtgtgtgaaaaatttgaatgctcagaagaggaggttctcagctgcctttat
aatagaaatcaccaggacccgttggcagttgcctatcacctcataatagataacaggagg
ataatgaatgaggccaaagatttttacttggcaacaagcccacctgattcttttctcgat
gatcatcatttgactcggccccatcctgaaagagtaccattcttggttgctgaaacgcca
agggcacgccacaccctcgatgaattaaacccacagaaatcaaaacaccaaggtgtaagg
aaagcaaaatggcatttgggaattagaagtcaaagtcgaccaaatgatatcatggcagaa
gtttgtagagcaattaaacaactggattacgaatggaaggttgtaaacccatattatttg
cgtgttcgaaggaagaatcctgtaacaagtacatactccaaaatgagtctacagttatac
caagtggatagtagaacgtacttactggatttccgtagcattgatgatgaaattactgaa
gccaaatcagggactgctactccacagagatcaggatcagttagcaactatcgatcttgc
caaaggaatgattcagatgctgatgctcaaggaaaatcctcagaagcttcacttacctca
tctgtgacctcacttgactcttctgttgacttaactccaagacctggaagtcacacgata
gagttttttgaaatgtgtgcgaatctaattaaaattcttgcacagtaa

KEGG   Felis catus (domestic cat): 101096000Help
Entry
101096000         CDS       T02385                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04710  Circadian rhythm
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101096000 (PRKAA2)
   04068 FoxO signaling pathway
    101096000 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    101096000 (PRKAA2)
   04152 AMPK signaling pathway
    101096000 (PRKAA2)
   04150 mTOR signaling pathway
    101096000 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101096000 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101096000 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101096000 (PRKAA2)
   04922 Glucagon signaling pathway
    101096000 (PRKAA2)
   04920 Adipocytokine signaling pathway
    101096000 (PRKAA2)
   04921 Oxytocin signaling pathway
    101096000 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    101096000 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    101096000 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101096000 (PRKAA2)
   04714 Thermogenesis
    101096000 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101096000 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    101096000 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096000 (PRKAA2)
   04931 Insulin resistance
    101096000 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101096000 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096000 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101096000 (PRKAA2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101096000 (PRKAA2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   101096000 (PRKAA2)
Membrane trafficking [BR:fca04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101096000 (PRKAA2)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101096000 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    101096000 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 101096000
NCBI-ProteinID: XP_023114511
Ensembl: ENSFCAG00000003080
Position
C1
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSFDSVTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggacactacgtgctgggtgac
acgctgggcgtcggcaccttcggcaaagtgaagattggagaacatcaattgacaggccat
aaagtggcagttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactctttcgccatcctcatattatcaaactatac
caggtgatcagcactccaacagatttttttatggtaatggaatatgtgtctggcggtgaa
ttatttgactacatctgtaaacatggacgggttgaagaggtggaagcaaggcgcctcttt
cagcagattctgtcagctgtggattactgtcataggcatatggtagttcatcgagacctg
aaaccagagaatgtgctgttggatgctcacatgaatgccaagatagcggattttggattg
tctaatatgatgtcggatggtgagtttctgcgaactagttgtggatctcccaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgatatctggagctgt
ggtgttatcttgtatgctctcctttgtggcaccctcccatttgacgatgagcatgtacct
acgttatttaagaagatccgagggggtgttttttatatcccagaatatctcaatcgttct
gttgccactctgttgatgcatatgctgcaggttgaccccctgaaacgggcaactatcaaa
gatataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaactggttcttttatggatgatagtgccatgcatattccc
ccaggcctgaagcctcatccagaaaggatgccacctcttatagcagacagccctaaagca
agatgtccattggatgcgctgaatacaactaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttggaatcagaagtcaaagcaaaccatatgacattatggccgaagtctac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatcttcgtgta
agaaggaaaaatccagtgactggcaattatgtgaaaatgagcttacaactttacctggtt
gacaacagaagctatcttttggactttaaaagcattgatgatgaggtggtggagcagagg
tctggttcgtcaacacctcagcgttcctgttccgctgctggcttacacagacccagatca
agttttgattctgtaacagcagagagtcattcactctctggctctcttactggctccttg
acaggaagcacactgtcttctgtttcacctcgcctaggcagtcacaccatggattttttt
gaaatgtgtgctagtctgatcactactttggcccgttga

KEGG   Felis catus (domestic cat): 101100119Help
Entry
101100119         CDS       T02385                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04710  Circadian rhythm
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101100119 (PRKAG2)
   04068 FoxO signaling pathway
    101100119 (PRKAG2)
   04152 AMPK signaling pathway
    101100119 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101100119 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101100119 (PRKAG2)
   04922 Glucagon signaling pathway
    101100119 (PRKAG2)
   04920 Adipocytokine signaling pathway
    101100119 (PRKAG2)
   04921 Oxytocin signaling pathway
    101100119 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    101100119 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    101100119 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101100119 (PRKAG2)
   04714 Thermogenesis
    101100119 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101100119 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101100119 (PRKAG2)
   04931 Insulin resistance
    101100119 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3
Motif
Other DBs
NCBI-GeneID: 101100119
NCBI-ProteinID: XP_023106520
Position
A2
AA seq 595 aa AA seqDB search
MGSSAMDTKKKKDVSSPGESSGKKNPSQKRRSLRVHIPDLSSFAMPLLDGDLESSEKHAS
RKVDSPCSSGSPSKGFFSRGPQHRPSSPVSAPVRPKASPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPSTSPGGIRFFSRSRKSSVRLTVESGDPASNTLLSAAPETR
ATASGLSSSPSTPTQAAKQHPFPLESYKHEPERLENRIYASTSPPDTGQRYCPSSFQSTA
GPPSASPTHHASSRTAALAAAPGPAEAGMLEKFELEEEAEDSESGVYMRFMRSHKCYDIV
PTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSP
MVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGN
ALYILTHKRILKFLQLFMSDMPKPAFMKQNLDALGIGTYHNIAFIHPDTPIIKALNVFVE
RRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCSKL
EILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGAKQKETETE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgggaagctcggccatggacaccaagaagaagaaagatgtttccagccccggcgagagc
agcggcaaaaaaaatcccagccagaagaggcgttcgctgcgagtgcacatcccggacctg
agttcctttgccatgcctctcctggacggagacctggagagctcagaaaagcatgcttct
cgtaaggtggacagcccctgcagctcgggcagcccctccaaagggttcttctctcgaggc
ccccagcaccggccctccagccccgtgtctgctcccgtgaggcccaaggccagccccggc
tctcccaaaaccgtgttcccattttcctaccaggagtcccctccgcgctccccacgccgc
atgagcttcagcgggatctttcgctcctcctccaaagaatcttcccccaactccaacccg
tctacctcgcccgggggcatcaggttcttctcccgctccagaaaaagttcggtgaggctg
accgtcgagtccggggaccctgcctcaaatactttgctgtccgcagcccccgagacgagg
gccacagcctcaggcctctcctcctctccgtcgacacccacccaagcggccaagcagcac
ccgtttcctctcgaatcctacaagcacgagcctgagcgactggaaaaccgcatctacgcc
tccacttcccctccggacacaggccagaggtactgcccgtcgtccttccagagcacagcc
gggcctccatcagcatcacccacgcaccatgcttcctccagaaccgcggcgctggcggcg
gccccgggacccgcggaagccggcatgctggagaaattcgagttggaagaagaagcagaa
gactcagagagtggcgtctacatgcgcttcatgaggtcacacaagtgttacgacatcgtt
cccaccagttcaaagcttgtggtgtttgatacaacgttacaagtgaagaaggccttcttt
gccttagtagccaatggtgtccgagcagcgccgctgtgggagagtaagaaacaaagtttc
gtaggaatgctaacaattacagatttcataaatatactacatagatactataaatcaccc
atggtacagatctatgaattagaggaacataagattgaaacatggagggagctttattta
caagaaacatttaagcctttagtgaatatatctccagatgcaagcctcttcgatgctgta
tactcgttgatcaaaaataaaatccacagattgccagttattgaccctatcagtgggaat
gcactttatatacttacccacaaaagaatcctcaagttcctccagctttttatgtctgat
atgccaaagcctgccttcatgaagcagaacctagacgcccttggcatcgggacctaccac
aacatcgccttcatccacccggacactcccatcattaaagccttgaacgtctttgtagaa
agacgagtgtcggccttgcctgtggtggatgagtcaggaaaagttgtagatatttattcc
aaatttgatgtcattaaccttgctgctgagaagacgtacaataacctagatatcacagtg
acccaggcccttcagcaccgctcacagtactttgagggcgtcgtgaagtgcagtaagctg
gaaatactggagaccatcgtggacagaatagtgcgggccgaggtgcatcggctggtggta
gtaaatgaagcagatagcatcgtgggtattatctccctgtcagacattctgcaggccctg
atactcacgcccgcaggtgccaaacaaaaggagacggaaaccgaatga

DBGET integrated database retrieval system