KEGG   Felis catus (domestic cat): 101092211Help
Entry
101092211         CDS       T02385                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca03420  Nucleotide excision repair
fca04115  p53 signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca05161  Hepatitis B
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00385  Cul4-DDB1-DDB2 complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101092211 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    101092211 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101092211 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092211 (DDB2)
   05202 Transcriptional misregulation in cancer
    101092211 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101092211 (DDB2)
   05212 Pancreatic cancer
    101092211 (DDB2)
   05225 Hepatocellular carcinoma
    101092211 (DDB2)
   05226 Gastric cancer
    101092211 (DDB2)
   05214 Glioma
    101092211 (DDB2)
   05216 Thyroid cancer
    101092211 (DDB2)
   05220 Chronic myeloid leukemia
    101092211 (DDB2)
   05217 Basal cell carcinoma
    101092211 (DDB2)
   05218 Melanoma
    101092211 (DDB2)
   05213 Endometrial cancer
    101092211 (DDB2)
   05224 Breast cancer
    101092211 (DDB2)
   05222 Small cell lung cancer
    101092211 (DDB2)
   05223 Non-small cell lung cancer
    101092211 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101092211 (DDB2)
   05169 Epstein-Barr virus infection
    101092211 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101092211 (DDB2)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101092211 (DDB2)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     101092211 (DDB2)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      101092211 (DDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 101092211
NCBI-ProteinID: XP_019667945
Ensembl: ENSFCAG00000025016
Position
D1
AA seq 484 aa AA seqDB search
MRRPLHSAAPIPVPARSWGTVPFRTEDAMAPRKRPETQKTPEVVVRPKTRRSRSPRELEP
EAKKLCVKGPGSSRRFDSGCLWAGLASLQVPPSYTSIVRALHHHKLGKAAWPSLQQGLQQ
SFVHSLASYRIFQKAAPFDRRATSLAWHPTHPSTLAVGSKGGDIMLWNFGIKDKPTFIKG
IGAGGSVTGLKFNPLDTNQFFTSSMEGTTRLQDFKGNTLRVFTSSDTCNIWFCSLDVSAR
SRMVVTGDNVGHVILLNMDGRELWNLRMHKKKVTHVALNPCCDWLLATASVDQTVKIWDL
RQVKGKSSCLHSLLHSHPVNAACFSPDGAQLLTTDQKSELRVYSASQWDCPPSLIPHPHR
HFQHLTPIKPSLSPCCSALKLQFLLTSALLMTSPVSAPKATWHPRYNLIVVGRYPDPNFK
SCTPHELRTIDVFDGSSGKMMYQLYDPESSGIISLNEFNPMGDTLASLMGYHILIWSQEA
GMRK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcccgctccactcggcggcacctattcctgtccccgcacggagttggggcaca
gtaccctttcgcacggaggacgcgatggctcccaggaaacgcccagaaacccagaagacc
cccgaggtggttgtgcgccccaagaccaggaggagcagaagcccccgggagctggagccc
gaggccaagaagctctgtgtgaagggccccggttctagcagaagatttgactcaggctgc
ctttgggcggggttggctagccttcaggtcccgccatcatacaccagcatcgtcagggcc
cttcaccaccataagctgggcaaagctgcctggccatcactacagcagggtctccagcag
tcctttgtgcactctctggcttcttaccggatattccaaaaggctgccccttttgacagg
agggccacatccttggcatggcacccaactcaccccagcaccctggctgtgggttccaaa
gggggagatatcatgctctggaactttggcataaaggacaaacccaccttcattaaaggg
attggagctggagggagcgtcactgggctgaagtttaaccctcttgataccaaccagttt
ttcacctcctcaatggagggaacaactaggctgcaagactttaaaggcaacacgctccga
gtgtttaccagctcagacacctgcaacatctggttttgcagcctggatgtgtctgccaga
agccgaatggtggtcacaggcgacaatgtgggacatgtgatcctgctgaacatggacggc
agggagctttggaatctgagaatgcacaaaaagaaagtgacccatgtggctctgaaccca
tgctgtgattggctcctggccacagcctctgtggaccaaacagtgaaaatctgggacctg
cgccaggttaaagggaaatccagctgcctccactcgctgctgcatagccatcctgtcaac
gcagcttgtttcagtcctgacggagcccagctcctgaccactgaccagaagagtgagctc
cgggtttactcggcctcccagtgggactgccccccgagcctgatcccacaccctcaccgc
cacttccagcacctgacgcccatcaagcccagcctatctccctgctgttctgccctcaaa
cttcagttcctgctgacctcagccttgctaatgacttctccagtctcagcccccaaggca
acctggcatcctcggtacaacctcattgttgtgggccgatacccagatcctaatttcaaa
agttgtaccccccatgaattaaggaccattgatgtgtttgatggaagctcagggaagatg
atgtatcagctctatgacccagaatcttctggtatcatttcgctcaatgagttcaatccc
atgggggacacgctggcctctctgatgggttatcacattctcatttggagccaggaagct
gggatgcggaaatga

DBGET integrated database retrieval system