KEGG   Felis catus (domestic cat): 101092310Help
Entry
101092310         CDS       T02385                                 

Gene name
JUP
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
fca  Felis catus (domestic cat)
Pathway
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
fca05226  Gastric cancer
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092310 (JUP)
   05202 Transcriptional misregulation in cancer
    101092310 (JUP)
  09162 Cancer: specific types
   05226 Gastric cancer
    101092310 (JUP)
   05221 Acute myeloid leukemia
    101092310 (JUP)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101092310 (JUP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101092310 (JUP)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101092310 (JUP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT V-ATPase_H_N Adaptin_N Cnd1 HEAT_2 Atx10homo_assoc DUF3361 KAP Arm_2 PUL
Motif
Other DBs
NCBI-GeneID: 101092310
NCBI-ProteinID: XP_011287440
Ensembl: ENSFCAG00000002133
UniProt: M3VXY4
Position
E1
AA seq 744 aa AA seqDB search
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTT
YTQVPQSQGDLEYQMSTTARAKRVREAMCPGVTGEDSSLLLATQVEGQATNLQRLAEPSQ
LLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMG
SPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVES
VLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQE
SKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHL
TSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCN
NSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYG
IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRH
VAAGTQQPYTDGVRMEEIVEGCAGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQ
RVAAGVLCELAQDKEAADAIDAEGASSPLMELLHSRNEGTATYAAAVLFRISEDKNPDYR
KRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDVPLDPLDMHMDMD
GDYPIDTYSDGLRPPYPAADHMLA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgatgaacctgatcgaacaacccatcaaggtgactgagtggcaacagacatac
acctatgactctggcatccactcgggggccaacacctgtgtgccctcggtcagtagcaag
ggcatcatggaggaggatgaggcctgcgggcgccagtacacgctcaagaagaccaccacc
tacactcaggtgccccagagccaaggagacctggagtaccagatgtccacgacggccaga
gccaagcgggtgcgggaggccatgtgtcctggagtgacaggtgaagacagctcactgctg
ctggccacccaggtggaggggcaggccaccaacctgcagcggctggccgagccgtcccag
ctgctcaagtcagccatcgtgcatctcatcaactaccaggacgacgccgagctggccacc
cgggccctgcccgaactcaccaaactgctcaacgatgaggacccggtggtagtgaccaag
gcagccatgatcgtgaaccagctgtccaagaaagaggcgtcgcggcgggcgctgatgggc
tcaccccagctggtggcagccgtggtgcgtacgatgcagaacaccagtgacctggacacg
gcccgctgcaccacgagcatcctgcataacctctcccaccaccgcgaggggctccttgcc
atcttcaagtcaggcggcatccctgccctggtccgcatgctcagctcccccgtggagtcg
gtcctgttctacgccatcaccacgctgcacaacctgctgctctaccaggagggcgccaag
atggcggtgcgcctggccgacgggctgcagaagatggtgcccctgcttaacaagaacaac
cccaagttcctggccatcaccaccgactgcctgcagctcctggcctacggcaaccaggag
agcaagctcatcatcctagccaacggaggaccccaggccctcgtgcagatcatgcgcaac
tacagttatgagaagctgctctggactaccagccgcgtgctcaaggtgctgtctgtgtgt
cccagcaataagcccgccattgtggaggctggtgggatgcaggccctgggcaaacacctg
acaagcaacagcccccgcctcgtacagaactgcctctggaccctgcgtaatctctcggac
gtggccaccaaacaggagggcctggagagcgtgctgaagatactggtgaaccagctgagc
gtggatgacgtcaatgtcctcacctgcgccacgggcacgctgtccaacctgacgtgcaac
aacagcaagaacaagacgctggtgacccagaacagcggcgtggaggctctcatccacgcc
atcctgcgcgccggcgacaaggacgacatcacggagcctgcggtctgcgccctgcgccac
ctcaccagccgtcacccggaggccgagatggcccagaactccgtgcgcctcaactacggc
atcccggccatcgtcaagctgctcaaccagcccaaccagtggccgctggtcaaggcaacc
atcggcctgatcaggaatctggccctgtgtccagccaaccatgcccctctgcaggaggcg
gcggtcattccccgcctcgtgcagttgctggtcaaggctcaccaggatgcccagcgccac
gtggctgcaggcacacagcagccatacacggacggcgtgaggatggaggagattgtggag
ggctgtgccggagccctgcacatcctcgcccgggaccccatgaaccgcatggagatcttc
cgactgaacaccatccccctgtttgtgcagctcctgtactcatcagtggagaacatccag
cgtgtagccgccggggtgctgtgcgagctggcccaggacaaggaggcagctgatgccatt
gatgccgagggggcctcgtccccactcatggagttactgcactctcgcaacgagggcaca
gccacctatgctgccgctgtcctgttccgcatctctgaggacaagaacccagattatcgt
aagcgtgtgtctgtggagctcaccaactccctcttcaagcatgacccagctgcctgggag
gccgcccagagcatgatccccatcaatgaaccctacgcagatgacatggatgccacctac
cgccccatgtactcgagtgacgtgcccctggaccctctggacatgcacatggacatggac
ggagactatcccatcgacacctacagcgatggcctgaggcccccctaccctgcggcggac
cacatgctggcctag

DBGET integrated database retrieval system