KEGG   Felis catus (domestic cat): 101092407Help
Entry
101092407         CDS       T02385                                 

Gene name
NF1
Definition
(RefSeq) neurofibromin isoform X1
  KO
K08052  neurofibromin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101092407 (NF1)
   04010 MAPK signaling pathway
    101092407 (NF1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101092407 (NF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGAP CRAL_TRIO_2 CRAL_TRIO MOR2-PAG1_C MIF4G_like_2
Motif
Other DBs
NCBI-GeneID: 101092407
NCBI-ProteinID: XP_023099294
Ensembl: ENSFCAG00000006065
Position
E1
AA seq 2884 aa AA seqDB search
MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTT
ILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHF
LHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELL
QYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQT
DMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKKLFL
DSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP
SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITN
STFKHGLGTASALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKE
KVTSLKFKEKPTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLV
QLVPQSHMPEIAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQM
LSSTEILKWLREILICRNKFLLKNKQADRSSCHFLFLYGVGCDVPSSGATSQMSMDHEEL
IRTCTPGASLRKGKGNSSMDSAAGCSGTPPICRQAQTKLEVALYMFLWSPDTEAVLVAMS
CFRHLCEEADIRCGVDEVSVHNFLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEH
PTAGNTEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDL
SDTDSLQEWINMTGFLCALGGVCLQQRSNSGLATYSPPMGPVSERKGSMISVMSSEGNAD
TPVSKFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQ
GQVLLTDTNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHA
IQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDL
DQASMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDENAQTG
GRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQ
QGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFD
SRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIV
ITSSDWQHVSFEVDPTRLEQSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCL
YQATCHSLLNKATVKEKKENKKSVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILD
KKPPPRIERGLKLMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPT
SDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGP
PEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYY
VARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPG
FAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKGSKRLIFIDCPGKLAEHIEHEQQKLPA
ATLALEEDLKVFHNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQSVFLNDIYYASEI
EEICLVDENQFTLTIANQGTPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQHTKIRPK
DVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFI
VSISKTLAANEPHLTLEFLEECISGFSKSSIELKHLCLEYMTPWLSNLVRFCKHNDDAKR
QRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKA
EVMADTAVALASGNVKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLML
SFNNSLDVAAHLPYLFHVVTFLVATGPLSLRASTHGLVINIIHSLCTCSQLHFSEETKQV
LRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETVTEA
LLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCISKRVSHGQIKQII
RILSKALESCLKGPDTYNSQVLIEATVIALTKLQPLLNKDSPLHKALFWVAVAVLQLDEV
NLYSAGTALLEQNLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNF
ALVGHLLKGYRHPSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTVSEE
VRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGDPSYRTLKENQPWSSPKGSEGYLAATY
PAVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPK
MRRVAETDYEMETQRISSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLTVLATLVK
YTTDEFDQRILYEYLAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSV
VYHEESPPQYQTSYLQSFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTYLPGIDE
ETSEESLLTPTSPYPPAVQSQLSITANLNLSNSMTSLATSQHSPEDSVSPSVIPRPASAS
FGSSLGCRCYSPTADLLRIDKENVELSPTSGHCNSGRTRHGSASQVQKQRSAGSFKRNSI
KKIV
NT seq 8655 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcacaggccggtggaatgggtccaggccgtggtcagccgcttcgacgagcag
cttccaataaaaacaggacagcagaacacgcataccaaagtcagtactgaacacaacaag
gaatgtcttattaatatttccaaatacaagttttctttggttatcagcggcctcaccact
atcttaaagaatgttaacaatatgagaatatttggagaagctgctgaaaaaaatttgtat
ctctctcagttgattatattggatacactggaaaaatgtcttgctgggcaaccaaaggac
acaatgagattagatgaaacgatgctggtcaaacagttgctgccagaaatctgccatttt
cttcacacctgtcgtgaaggaaaccaacatgcagctgaacttcggaattctgcatctggg
gttttattttctctcagctgcaacaacttcaatgcagtgtttagtcgcatctctaccagg
ttacaggaattgactgtttgttcagaagacaatgttgatgttcatgatatagaattgtta
cagtatatcaatgtggattgtgcaaaattaaaacgactcctaaaggaaacagcatttaaa
tttaaagccctaaagaaggttgcacagttagcagttataaatagcctggaaaaagcattt
tggaactgggtagaaaattatccagatgaatttacaaagctgtaccagattccacagact
gatatggctgagtgtgcagaaaaactgtttgacttggtggatggttttgccgaaagcacc
aagcgtaaagcagcggtttggccactgcaaatcattctccttatcttgtgtccagaaatc
attcaggatatctccaaggatgtggttgatgaaaacaacatgaataagaagttgtttctg
gacagcctacggaaagcacttgccggccatggaggaagcaggcagctgacggagagtgct
gcaatagcctgtgtcaaactgtgcaaagcaagtacttatatcaactgggaagacaactct
gtcattttcctcctagtccagtccatggtggttgatcttaagaacctgctttttaatcca
agtaagccattctcaagaggcagtcagcccgcagatgtggatctgatgattgactgcctt
gtctcttgctttcgtataagccctcacaacaaccaacactttaagatctgcctggctcag
aattccccttctacatttcactatgtgctggtaaattcactccatcgaatcatcaccaat
agcactttcaagcatggacttggcactgcttctgcgttggattggtggcctaagatcgat
gctgtatattgtcactcagtcgagcttcgaaacatgtttggtgaaacgcttcataaagca
gtgcagggttgtggcgcacacccagcaatacgaatggcaccgagtcttacatttaaagaa
aaagtaacaagccttaaatttaaagaaaaacctacagacctggagacaagaagctataag
tatcttctcctgtccatggtgaaactcattcatgcggatccaaagctcttgctttgtaat
ccaaggaaacaggggcctgaaacccaaggcagtaccgcagaattaattacagggctcgtc
cagctggtccctcagtcacacatgccagagatcgcacaggaggcaatggaggctctgctc
gttcttcatcagttagatagcattgatttgtggaatcctgatgctcctgtggaaacattt
tgggaaattagctctcaaatgcttttttacatctgcaagaaattaactagccatcaaatg
cttagtagcacagaaattctcaaatggttgcgggaaattttgatctgcaggaataaattt
cttcttaaaaataagcaggcagatagaagttcctgtcactttctcttcctttacggggta
ggatgtgatgttccttcgagtggagctaccagtcagatgtccatggatcatgaagaatta
atacgtacttgtacgcctggagcctctcttcggaagggaaaaggaaactcatccatggat
agtgcagcagggtgcagcggcacaccgccgatatgccgacaggctcagaccaaactcgaa
gtggccctgtacatgtttctgtggagccctgacactgaagctgttctggttgccatgtcc
tgtttccgccacctctgtgaggaggcagacatccggtgtggggtggatgaagtgtcggtg
cacaacttcttgcccaactataacacgttcatggaatttgcctctgtcagcaatatgatg
tcaacaggaagagcagcacttcagaaaagagtgatggcactactcaggcgcatcgagcac
cccacggcaggaaacacggaggcttgggaagatacacatgcaaagtgggaacaagccaca
aaactaatcctcaactatccaaaagctaaaatggaagatggccaggctgctgaaagcctt
cacaagaccattgttaagaggcgaatgtctcatgtgagtggaggaggatccatagatttg
tctgacacggactccctacaggaatggatcaacatgactggcttcctttgcgcccttggg
ggagtgtgcctgcagcaaagaagcaactctggcttggcaacctatagcccccctatgggc
ccagtcagtgaacgcaagggttccatgatttcggtgatgtcctcggagggaaatgcagat
acacctgtcagcaaatttatggatcggctgttatccttaatggtgtgtaaccatgagaaa
gtgggacttcaaatacggaccaacgttaaggatctggtgggtctagaattgagtcctgct
ctttatccaatgctatttaacaaattgaagaataccatcagcaagttttttgactcgcaa
ggacaggttttattgaccgacaccaatactcagtttgtggagcaaaccatagctataatg
aagaacttactagataatcataccgaaggcagctccgaacatctggggcaagctagcatt
gaaacaatgatgttaaatctagtcagatacgttcgagtgcttgggaacatggtccatgca
attcaaataaaaacgaaactgtgtcagttagtcgaggtaatgatggcaaggagagatgac
ctctcattttgtcaagagatgaaatttaggaataagatggtagaatacctgacagactgg
gtcatgggaacatcaaaccaagcagcagatgatgatgtaaaatgtcttacaagagacttg
gaccaggcgagcatggaagccgttgtttcactcctggctggtcttccactgcagcctgag
gaaggagatggtgtggaattgatggaagccaagtcacagttatttctgaagtatttcaca
ttgtttatgaaccttttgaatgactgtagtgaagttgaagatgaaaatgcacaaacaggt
ggcaggaaacgtggcatgtcccggaggctggcatcactgaggcactgcacagtccttgca
atgtccaacttactcaatgctaatgtggacagtggcctcatgcactccataggtttaggt
tatcacaaagatcttcagacaagagctacatttatggaagttctgacaaaaatcctccag
caaggcacagaatttgacacgcttgcagaaacggtgctggccgaccggtttgagaggctg
gtggagttggtcacaatgatgggagaccagggagagctcccaatagccatggctttggcc
aacgtggtcccgtgttctcagtgggatgaactagctcgagttctagtgactctgtttgat
tctcggcatttgctctaccaactgctctggaacatgttttctaaggaagtagaattggca
gactccatgcagactcttttccgaggaaacagcttagccagtaaaataatgaccttctgt
ttcaaggtatatggtgctacctacctacaaaaactcctggatccgttattacgaatcgtg
atcacatcctctgattggcaacatgttagctttgaagtggatcctaccaggttagaacaa
tcagagagccttgaggaaaaccaacggaaccttctgcagatgactgaaaagttcttccat
gccatcatcagttcctcctcagaattcccccctcagcttcgaagtgtgtgccactgttta
taccaggcaacttgccactccctactgaataaagctacagtaaaagaaaaaaaggaaaac
aaaaaatcagtggttagccagcgtttccctcagaacagcatcggtgcggtgggaagtgcc
atgttcctcagatttatcaatcctgccattgtctcaccgtatgaagcagggattttagat
aaaaagccaccacctagaattgaaaggggcttgaagttaatgtcaaagatacttcagagc
attgccaatcatgttctcttcacaaaagaagagcatatgcggccttttaatgattttgtg
aaaagcaactttgatgcagcgcggaggtttttccttgatatagcatctgattgtcctacc
agtgatgcagtaaatcatagtctctccttcatcagtgatggcaatgtgcttgctttacat
cgtctactctggaacaatcaagagaaaattggccagtatctttccagtaacagggatcac
aaagctgttggaagacgaccttttgataagatggcaacacttcttgcgtacttgggtcct
ccagagcacaaacctgtggccgatacacattggtccagccttaaccttaccagttcaaag
tttgaggaatttatgactaggcatcaagtacatgaaaaagaagagttcaaggctttgaaa
acattaagtattttctaccaagctgggacttccaaagctgggaatcctatattttattat
gttgcacggaggtttaaaactggccaaatcaatggcgatttgctgatataccacgtcttg
ctgactttaaagccatattatgcaaagccatatgaaattgtagtggaccttacccatact
gggcctagcaatcgctttaaaacggactttctctccaagtggtttgttgtttttcctggc
tttgcttatgacaatgtctctgcagtctatatctataactgcaactcctgggtcagagag
tataccaagtatcacgaacggctactgactggcctcaaaggcagcaagaggctcattttc
atcgactgtcctgggaaactggctgagcacatagagcatgaacaacagaaactgcctgct
gccacactggctttagaagaggacctgaaggtattccacaatgctctcaagctagctcac
aaagacaccaaggtttctattaaagttggttctactgctgttcaagtaacctcagcagag
cgaacgaaagtcctaggacagtcggtctttctaaatgatatctattatgcttcggaaatt
gaagagatctgcctggtggatgagaaccagtttaccttaaccattgcaaaccagggcaca
ccgctcaccttcatgcaccaggagtgcgaagccatcgtccagtctatcattcacatccgg
acacgctgggagctgtcgcagcccgactccatcccccagcacaccaagattcggccaaaa
gacgtccctgggacactactcaatattgcattacttaatttaggcagttccgaccctagt
ttacggtcagctgcctataatcttctctgtgccttaacttgtacctttaatttaaaaatc
gagggccagctactagagacgtcaggtttatgcatccctgccaacaacaccctctttatt
gtctctattagtaagacactggcggccaatgagccacatctcaccttagaatttttggaa
gagtgtatttctggatttagcaaatctagtattgaattgaaacacctttgtttggaatac
atgactccatggctgtcaaacctggtccgtttttgtaagcacaatgatgatgccaaacga
caaagagttaccgccattctcgataagctgataacaatgaccataaatgagaaacagatg
tacccatctattcaagccaaaatatgggggagccttgggcagattacagatctccttgac
gttgtactagacagtttcatcaaaaccagtgcgacaggtggcttgggatcaataaaagcc
gaggtgatggcagatactgccgtagctttggcttctggaaatgtgaaattggtttccagc
aaggttattggaaggatgtgcaaaataattgacaagacatgcttgtctccaactcctacc
ttagaacagcatctcatgtgggacgacattgccatcctcgcacgctacatgctgatgctg
tccttcaacaattcccttgacgtggcagctcatctcccctacctcttccacgttgttact
ttcttagtagccacggggccgctctcccttagagcttccacacacggattggtcattaat
atcattcactccctgtgtacttgttcacagctgcattttagtgaagagaccaagcaagtt
ttgagactcagtttgacagagttctcattacccaagttttacttgctgtttggcattagc
aaagtcaagtcagctgcggtcattgccttccgctccagttaccgggacaggtcgttctct
cctggctcctatgagagggagacttttgctttgacatccttggaaacagtcacagaagct
ttgttggagataatggaggcatgtatgagagatattccaacatgcaagtggctggaccag
tggacggaactagctcaaagattcgcattccagtataatccatccctgcaaccgagagct
cttgttgtctttggctgtattagcaagcgagtgtctcatgggcagataaagcagattatc
cgtattcttagcaaggcacttgaaagttgcttaaaaggacctgatacttacaacagtcaa
gttctgatagaagccacagtaatagcgctaaccaaattacagccgctcctcaataaggac
tcccctctgcacaaagccctcttttgggtagctgtggctgtgctacagctcgatgaggtc
aacttgtattcagcaggcaccgcccttcttgaacaaaacctgcacaccttagacagtctg
cggatattcaatgacaagagtccagaggaagtatttatggcaatccggaaccctctggaa
tggcactgcaagcagatggatcattttgttggactcaatttcaactctaactttaacttc
gcgctggttggacacctcttaaaagggtacaggcatccttcacctgccattgttgcaaga
acggtcagaattctgcatacactactgactctggtcaacaaacatagaaactgtgacaaa
tttgaggtgaacacacagagcgtggcttacttggcagccttactcacagtgtctgaggag
gttcgaagtcgctgtagcctaaaacatagaaagtctcttcttcttactgatatttcaatg
gaaaatgttcctatggatacatatcccatccatcatggcgaccccagctataggacgcta
aaggagaaccagccgtggtcatctcccaaaggttctgaggggtaccttgcagccacctat
ccagccgtgggccagaccagtccccgggccaggaagtccatgagcttggacatggggcag
ccttctcaggccaacacgaagaagttgctgggaacaaggaaaagttttgatcacttgata
tcagacacaaaggctcctaaaaggcaagaaatggaatcagggatcacaacaccccccaaa
atgaggagagtagcagaaactgattatgaaatggaaactcagcggatttcctcatcacaa
caacacccgcatttgcgtaaagtttcggtgtctgaatcaaatgttctcttggatgaagaa
gtacttactgatccaaagatccaagcgcttcttctgaccgttctggctacgctggtaaaa
tataccacggatgagtttgatcagcgaattctttatgaatacttagcggaagccagtgtt
gttttccccaaggtttttccagtcgtacacaatttgttggactctaagatcaacaccctg
ttgtcattgtgccaagatccaaatttgttaaatccaattcatggaattgtgcagagtgtg
gtgtaccatgaggaatctccaccacagtaccagacatcgtacctgcaaagttttggtttt
aatggcttgtggcggtttgcaggacccttttcaaagcaaacccaaatcccagactatgct
gagcttattgttaagtttcttgatgccttgattgacacgtatttgcctggaattgatgaa
gaaaccagtgaggagtccctcctgacacccacttctccttatcctcctgcagtgcagagc
cagcttagtatcactgctaaccttaacctttctaattccatgacctcactcgcaacttcc
cagcattccccagaggacagtgtttctccaagtgtgattcctagaccagcatcagcgtca
tttgggagctcgctaggatgcaggtgctacagtcccactgcagacctcctacggatcgac
aaggagaacgttgaactctcccccacctctggccactgtaacagtggacgcactcgccat
ggatccgcaagccaggtgcagaagcaaagaagcgctggcagtttcaaacgtaatagcatt
aagaagatcgtgtga

DBGET integrated database retrieval system