KEGG   Felis catus (domestic cat): 101092552Help
Entry
101092552         CDS       T02385                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04071  Sphingolipid signaling pathway
fca04270  Vascular smooth muscle contraction
fca04350  TGF-beta signaling pathway
fca04360  Axon guidance
fca04510  Focal adhesion
fca04530  Tight junction
fca04611  Platelet activation
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca05132  Salmonella infection
fca05135  Yersinia infection
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101092552 (ROCK1)
   04071 Sphingolipid signaling pathway
    101092552 (ROCK1)
   04024 cAMP signaling pathway
    101092552 (ROCK1)
   04022 cGMP-PKG signaling pathway
    101092552 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092552 (ROCK1)
   04530 Tight junction
    101092552 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101092552 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101092552 (ROCK1)
   04670 Leukocyte transendothelial migration
    101092552 (ROCK1)
   04062 Chemokine signaling pathway
    101092552 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101092552 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101092552 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    101092552 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092552 (ROCK1)
   05206 MicroRNAs in cancer
    101092552 (ROCK1)
   05205 Proteoglycans in cancer
    101092552 (ROCK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101092552 (ROCK1)
   05135 Yersinia infection
    101092552 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101092552 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101092552 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101092552 (ROCK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101092552 (ROCK1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   101092552 (ROCK1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101092552 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 Cortex-I_coil HR1 APH Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 101092552
NCBI-ProteinID: XP_011286381
Ensembl: ENSFCAG00000031506
Position
D3
AA seq 1355 aa AA seqDB search
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRSSPNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKVEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
TQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKTQMD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLSLQLEQES
NKRVLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLTTQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSMLTKDLELLRKENE
ELTDKMRRTEEEYKLKKEEEINNLKATYEKNISTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSAKTSS
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatctaccaggaag
gtatatgctatgaagcttcttagtaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagagacatcatggcttttgctaacagtccttgggtcgttcagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggagtacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgattctacactgca
gaagtagttcttgcattggatgcaatccattccatgggtttcattcatagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttggaacacccgattac
atttcccctgaagtattaaaatctcaaggtggtgatggttattatggacgagaatgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctctggttggaacttatagtaagattatgaaccataaaaattcacttactttccct
gatgataatgatatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaggtgagattaggacgaaatggtgtggaagaaatcaaacgacatcttttcttcaaaaat
gatcagtgggcttgggaaacactcagagacactgtagcgccagttgtacctgatttaagt
agcgacattgatacaagtaattttgatgacttggaagaagataaaggagatgaagaaaca
ttccctatacctaaagcttttgttggcaatcagttaccttttgtaggatttacgtattat
agcaatcgtagatacttatcttcagcaaatcctaatgataaccgaagtagccccaatgtg
gataaaagcttgcaggaaaatttgcaaaaaacaatttataagctggaagaacaactgcat
aatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacttcaaacataaaacta
gacaagataatgaaagaattggatgaagagggaaatcaaagaagaaacctagagtctaca
gtgtctcagattgagaaagagaaaatgttgctacagcatagaattaatgagtaccaaaga
aaagtagaacaggaaaatgagaagaggagaaatgtagaaaatgaagtttctacattaaag
gatcagttagaagacttaaagaaagtaagtcaaaattcacagcttgctaatgagaagctg
acacagttacaaaagcagctagaagaagccaatgacttacttaggacagaatcagacaca
gctgtaagattaaggaagagtcacacagagatgagtaagtcaattagtcagctagagtcc
ttaaacagagaattgcaggagagaaatagaattttagagaattccaagacacaaatggac
aaggactattaccagctgcaagctgtgttagaagctgaacgaagagacagaggtcatgat
tctgagatgattggagaccttcaagctcgaattacatctttacaagaagaggtaaagcat
ctcaagcataatcttgaaagagtggaaggagaaagaaaagaagctcaagacatgcttaat
cactcagaaaaggaaaagaataatttagagatagatttaaactataagcttaaatcatta
caacaaaggttagaacaagaggtaaatgaacataaagtaaccaaagctcgtttaactgac
aaacatcagtctattgaagaggcaaagtctgttgcaatgtgtgaaatggaaaagaagctg
aaggaagagagagaagctcgagagaaggctgaaaatagagttgttcagattgagaaacag
tgttcaatgctagatgttgatctgaaacaatctcagcagaagcttgagcatttgactgaa
aataaagaaaggatggaggatgaagttaagaatctatccctgcaactggagcaggaatca
aataagcgagtattgttacagaatgaattgaagactcaagcatttgaagcggacaattta
aaaggtctagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgagttagctcagcttacaaaacagtatagaggaaatgaaggacagatgcgg
gagctacaagatcagcttgaagcagagcaatatttttcgacactttataaaacccaagta
aaggaacttaaggaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgaaaaagaaactcttactactcagttggatctagcagaaacaaaagccgag
tctgagcagttggctcgagggcttctggaagaacagtattttgaattgacccaagaaagc
aagaaagctgcctcaagaaatagacaggagattacagataaagatcacactgttagtcgg
cttgaagaaacaaacagcatgctaaccaaagatcttgaattattaagaaaagaaaatgaa
gagctaactgataaaatgaggaggacagaggaagaatataaactgaagaaagaggaagag
atcaataatcttaaggctacctatgaaaagaatatcagtacagaaagaacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcggaaagattttaaaattgatagaaag
aaagctaatacacaggatttgagaaagaaagaaaaggaaaatcgaaagcttcaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtggtgaaacatcagaaggaactgaat
gacatgcaagcgcaattggtagaagaatgtacacataggaatgagcttcagatgcaattg
gctagcaaagagagtgatattgagcaattgcgtgctaaacttttggacctttcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatggaaaccttccagagtcaaga
attgaaggctggctttcaataccaaacagaggaaatatcaaacgatatggctggaagaaa
cagtatgttgtagtaagcagcaaaaaaattttgttctataacgatgagcaagataaggaa
caatccaatccatccatggtattggacatagataaattgtttcatgttcgacctgtaacc
caaggagatgtttacagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatgtagagatggaaccagtacagcaagctgaaaag
actaattttcaaaaccacaaaggccatgagttcattcctacactctaccactttcccgcc
aactgtgaggcctgtgccaaacctctctggcatgtttttaagccacctcctgccctagaa
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaggacttaatt
tctccatgtaaagtcagttatgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaaatgggtaacacatttggtgaagaagatccctaagaatcca
ccatctggttttgttcgtgcatcccctcgaacactttctacaagatccactgcaaatcag
tctttccgaaaagtcgtcaaaaatacatctgcaaaaactagcagttaa

DBGET integrated database retrieval system