KEGG   Felis catus (domestic cat): 101092673
Entry
101092673         CDS       T02385                                 

Gene name
ZBTB46
Definition
(RefSeq) zinc finger and BTB domain-containing protein 46 isoform X1
  KO
K10517  zinc finger and BTB domain-containing protein 46
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101092673 (ZBTB46)
   04121 Ubiquitin system [BR:fca04121]
    101092673 (ZBTB46)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    101092673 (ZBTB46)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     101092673 (ZBTB46)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-H2C2_5 zf-C2H2_4 DUF3342 zf-C2H2 zf-met BTB_3 zf-Di19 DUF4428
Other DBs
NCBI-GeneID: 101092673
NCBI-ProteinID: XP_003983331
Ensembl: ENSFCAG00000001175
Position
A3
AA seq 589 aa
MNNRKEDMEIASHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLY
CQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQA
CHDFIKAALDISIKPDASDELSEFEISAPPGSSTDALISAVMAGRSISPWLARRTSPANS
SGDSAIASCHEGGSSYGKEDQEPKADGPDDISSQPLWPGDVGYGSLRVKEEQISPSHYGG
SELPSSRDAVIQNSFSEQAGGDGWQPTGRRKNRKNKETVRHITQQAEGDSRAGSPVAPFL
PTSGWPFGGRDSGADLTVAEASSSDSRGERAELYGHVDEGLLGGEASYLGPPLTPEKDEA
LQQAAAVANLRAALMSKNSLLSLKADVLGDDSSLLLEYLPKGTHSLSLNEFTVIRKKFKC
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKLCS
RVFMSAASVGIKHGSRRHGVCADCAGRGVAGPLDGGGTEGSPELFPGDGPYLEDPDDPRG
EGEEELCEDEDEVGLAHEDALLAAEKGDEDSPRGPGSPPGAPDKDFWIS
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaacaaccgaaaggaagacatggagattgcgtcccactaccggcacctgctgcgggaa
ctgaacgagcagcggcagcacggcgtcctgtgcgacgtgtgcgtcgtggtggagggcaag
gtcttcaaggcgcacaagaacgtcctgctcggcagcagccgctactttaagacgctgtac
tgccaggtgcagaagacgtccgagcaggccacggtcacgcacctggacatcgtcacggcg
cagggcttcaaggccatcatcgacttcatgtactctgcccacctggccctcaccagcagg
aacgtcatcgaggtgatgtccgccgccagcttcctgcagatgacggacatcgtgcaggcc
tgccacgacttcatcaaggccgcgctggacatcagcatcaagcccgacgcctcggacgag
ctctccgagttcgagatcagtgcccctcctggcagcagcacggacgccctcatctcggcc
gtgatggcgggaaggagcatctccccgtggctggcccggcgcaccagccccgccaattct
tccggagactcggccatcgccagctgccacgaagggggcagcagctacgggaaggaggac
caggagcccaaggctgacggccccgacgacatttcttcgcagccgctgtggcccggggac
gtgggctacgggtctctgcgcgtcaaggaagagcagatctccccgtctcattacggaggg
agtgagctcccttcctccagggatgcggtgatacagaactctttctcggagcaggctggc
ggggacggctggcagcccacgggtcgcaggaagaaccggaaaaacaaagagacggtccgg
cacatcacacagcaggcggagggcgatagccgggccggctccccggtggcccctttcctt
ccgacgtccgggtggccattcggcggccgcgactcaggcgcggacctgactgtcgctgaa
gccagcagctctgacagccgcggggagagggctgagctgtacggccacgtggacgagggt
ctcctgggaggagaggccagctacctgggcccgcccctcacccccgagaaggacgaggcc
ctgcagcaggccgccgcggtggccaacctgcgggcggcactcatgagtaagaacagcctg
ctgtccctcaaggcggacgtgctcggggacgacagctccctgctgctggagtacctgccc
aagggcacccactctctgtccctcaacgagttcacggtgatcaggaagaagttcaagtgc
ccgtactgcagcttctcggccatgcaccagtgcatcctcaagcggcacatgcgctcccac
acgggcgagcggccctacccctgcgagatctgcggcaagaagttcacgcggcgcgagcac
atgaagcggcacacgctggtccacagcaaggacaagaagtacgtgtgcaagttgtgcagt
cgggtgttcatgtcagccgccagcgtgggcatcaagcacggctcccggcgccacggtgtc
tgtgccgactgcgcaggccgcggtgtggccggtcccctggatggcggtggcactgagggc
tcccccgagctgttccctggcgacgggccctacctggaagatcccgacgacccgcggggg
gagggcgaggaggagctgtgtgaggacgaggacgaggtgggcctggcccacgaggacgcg
ctgctggcggccgagaagggggacgaggactctccgcggggtcctggcagccccccaggg
gcaccggacaaggacttctggatctcctag

DBGET integrated database retrieval system