KEGG   Felis catus (domestic cat): 101093220Help
Entry
101093220         CDS       T02385                                 

Gene name
CNP
Definition
(RefSeq) 2',3'-cyclic-nucleotide 3'-phosphodiesterase isoform X1
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101093220 (CNP)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     101093220 (CNP)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   101093220 (CNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase AAA_33 6PF2K Zeta_toxin AAA_22 KTI12 AAA_18 AAA_16 ABC_tran AAA_30 AAA_17 NACHT AAA AAA_5 DUF4823 CPT
Motif
Other DBs
NCBI-GeneID: 101093220
NCBI-ProteinID: XP_003996919
Ensembl: ENSFCAG00000022165
UniProt: M3WWG3
Position
E1
AA seq 420 aa AA seqDB search
MNRSFSRKSHAFLPKIFFRKMSSSGAKDKPELQFPFLQDEETVATLQECKTLFILRGLPG
SGKSTLARVIVDRYRDGTKMVSADAYKINPGIRGDFSEEYKRLDEDLAAYCRRDIRVLVL
DDTNHERERLEQLFDMADQYQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADELKKLKPGL
EKDFLPLYFGWFLTKKSSESLRKAGQAFLEELGNHKAFKKELRHFVSGDEPREKIELVTY
FGKRPPGVLHCTTKFCDYGKAAGAEEYAQQDVVKKSYGKAFTLTVTALFVTPKTAGARVE
LSEQELPLWPNDVDKLSPSDSLPRGSRAHITLGCAGDVEAVQTGIDLLEIVRQEKGGSRG
EEVGELHRGKLYSLGSGRWLLSLAKKMEVRAIFTGYYGKGKPVPTHGSRKGGAFQSCTVI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaagcttctcccgaaagagccacgcgttcctgcccaagatcttcttccgcaaa
atgtcatcctcaggggccaaggacaagcctgagctgcagtttcctttcctgcaggatgag
gagacggtggccacactgcaagagtgcaagacgctcttcatcctgcgaggcctgccgggg
agcggcaagtccacgctggcgcgggtcattgtggacaggtaccgcgacggcaccaagatg
gtgtctgccgacgcgtacaagattaaccccggcattcgaggagacttctctgaggagtac
aagcggctggacgaggacctggcggcctactgccgccgggacatccgcgtcctggtgctg
gacgacaccaaccacgagcgggagcggctggagcagctctttgacatggccgaccagtac
cagtaccaggtggtgctggtggagcccaagacggcgtggcggctggactgtgcccagctc
aaggagaagaatcagtggcagctgtcggccgacgagctgaagaagctgaagccggggctg
gagaaggacttcctgccgctctacttcggctggttcctgaccaagaagagttccgagagc
ctccgcaaagccggccaggccttcctggaggagctggggaaccacaaggccttcaagaag
gagctgcgacactttgtctctggggatgagcccagggagaagattgaactggtcacctac
tttgggaagagacccccaggcgtgctgcactgcacaaccaagttctgtgactacgggaag
gctgctggggcagaagagtatgcccagcaggatgtggtgaagaaatcctacggcaaggcc
ttcacgctgaccgtcactgccctcttcgtgacgcccaagactgccggagcccgggtggag
ctgagcgagcaggagctgccgctgtggccaaatgacgtggacaagctgtccccctctgac
agcctgccccggggcagccgtgctcacatcaccctcggctgcgcgggggacgtggaggcc
gtgcagacgggcattgacctcctggagattgtgcggcaggagaaggggggcagccgaggc
gaggaggtgggtgagctacaccggggcaaactctactccttgggcagcgggcgttggctg
ctgagcctggccaagaagatggaggtcagggccatcttcacggggtactacgggaagggc
aaacctgtgcccacgcacggcagccgcaaggggggtgccttccagtcctgcaccgtcatc
tga

DBGET integrated database retrieval system