KEGG   Felis catus (domestic cat): 101093368Help
Entry
101093368         CDS       T02385                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04114  Oocyte meiosis
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04914  Progesterone-mediated oocyte maturation
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
fca05222  Small cell lung cancer
fca05226  Gastric cancer
Module
fca_M00692  Cell cycle - G1/S transition
fca_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101093368 (CDK2)
   04151 PI3K-Akt signaling pathway
    101093368 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101093368 (CDK2)
   04114 Oocyte meiosis
    101093368 (CDK2)
   04115 p53 signaling pathway
    101093368 (CDK2)
   04218 Cellular senescence
    101093368 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101093368 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093368 (CDK2)
   05203 Viral carcinogenesis
    101093368 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101093368 (CDK2)
   05215 Prostate cancer
    101093368 (CDK2)
   05222 Small cell lung cancer
    101093368 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101093368 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101093368 (CDK2)
   05162 Measles
    101093368 (CDK2)
   05161 Hepatitis B
    101093368 (CDK2)
   05160 Hepatitis C
    101093368 (CDK2)
   05169 Epstein-Barr virus infection
    101093368 (CDK2)
   05165 Human papillomavirus infection
    101093368 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101093368 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101093368 (CDK2)
   03036 Chromosome and associated proteins [BR:fca03036]
    101093368 (CDK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101093368 (CDK2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101093368 (CDK2)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101093368 (CDK2)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101093368 (CDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 101093368
NCBI-ProteinID: XP_003988917
Ensembl: ENSFCAG00000013973
UniProt: A0A2I2V4K7
Position
B4
AA seq 298 aa AA seqDB search
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acagagggtgtacccagtactgctatacgagagatttctctgcttaaggagcttaaccac
cctaacattgtcaagctgctggatgtcatccacacagaaaacaaactctacctagttttt
gagtttctgcaccaggatctgaagaaattcatggatgcctctgctttgactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagccttctgccattct
catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagtacctgttcgtacttacacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac
tccacagctgtagatatctggagcctgggctgcatctttgctgagatggtgacccgccga
gccctatttcctggagattccgaaatcgaccaactcttccggatcttccggactctgggg
accccagatgaagtggtttggccaggagttacttctatgcctgattataagccgagtttc
cccaagtgggcccggcaagattttagcaaagttgttcctcccttggatgaagatggacgg
agcttgctgtcgcaaatgctgcactacgaccccaacaagcggatttcggcaaaggcagct
ctggctcaccctttcttccaggatgtgaccaagccagtgccccaccttcgactctga

DBGET integrated database retrieval system