KEGG   Felis catus (domestic cat): 101093435Help
Entry
101093435         CDS       T02385                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca05160  Hepatitis C
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101093435 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101093435 (BAK1)
   04215 Apoptosis - multiple species
    101093435 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093435 (BAK1)
   05202 Transcriptional misregulation in cancer
    101093435 (BAK1)
   05206 MicroRNAs in cancer
    101093435 (BAK1)
   05203 Viral carcinogenesis
    101093435 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101093435 (BAK1)
   05212 Pancreatic cancer
    101093435 (BAK1)
   05225 Hepatocellular carcinoma
    101093435 (BAK1)
   05226 Gastric cancer
    101093435 (BAK1)
   05214 Glioma
    101093435 (BAK1)
   05216 Thyroid cancer
    101093435 (BAK1)
   05220 Chronic myeloid leukemia
    101093435 (BAK1)
   05217 Basal cell carcinoma
    101093435 (BAK1)
   05218 Melanoma
    101093435 (BAK1)
   05213 Endometrial cancer
    101093435 (BAK1)
   05224 Breast cancer
    101093435 (BAK1)
   05222 Small cell lung cancer
    101093435 (BAK1)
   05223 Non-small cell lung cancer
    101093435 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101093435 (BAK1)
   05162 Measles
    101093435 (BAK1)
   05164 Influenza A
    101093435 (BAK1)
   05160 Hepatitis C
    101093435 (BAK1)
   05168 Herpes simplex virus 1 infection
    101093435 (BAK1)
   05163 Human cytomegalovirus infection
    101093435 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101093435 (BAK1)
   05169 Epstein-Barr virus infection
    101093435 (BAK1)
   05165 Human papillomavirus infection
    101093435 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101093435 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101093435 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101093435 (BAK1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101093435 (BAK1)
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   101093435 (BAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 101093435
NCBI-ProteinID: XP_003986075
Ensembl: ENSFCAG00000013657
UniProt: A0A2I2UUV3
Position
B2
AA seq 211 aa AA seqDB search
MASGQGPGPPRQECEETAPSATSEEQVARDTEEVFRSYVFHRYQQEQEAEGAAAPTDPEI
VTLPLEPSSTMGQVGRQLAIIGDNINQRYDSEFQAMLQRLQPTAENAYELFTKIASSLFE
SGINWGRVVALLGFGYRLALHIYQHGLTGFLGQVTKLVVDVMLRHCIARWIAQRGGWVAA
LNLGNGPIVNVLIVLSVVLLGQFVVRRFFKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgggcaaggcccaggtcctcccaggcaggagtgtgaagagactgccccgtct
gctacttctgaggagcaggtagcccgggacaccgaggaggttttccgcagctatgttttt
caccgttatcagcaggagcaggaggctgagggggcagctgcgcctactgacccagaaata
gtcaccttgcccctagaacctagcagcaccatggggcaggtgggtcggcagctcgccatc
attggggacaacatcaaccagcgctacgattcagagttccaggccatgctgcagcgcctg
caacccacagcagagaacgcctatgaacttttcaccaagattgcctcgagtctatttgag
agcggcatcaactggggccgagtggtggctctcctgggctttggctaccgcctggctcta
cacatctaccagcacggcctgaccggcttcctgggccaggtgaccaaactggtggtcgac
gtcatgctgcgtcactgcattgcccggtggattgcgcagaggggcggctgggtggcagcc
ctgaacttgggaaatggccccatcgtgaacgtgctgatagttctgtctgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system