KEGG   Felis catus (domestic cat): 101093558Help
Entry
101093558         CDS       T02385                                 

Gene name
ARRB2
Definition
(RefSeq) beta-arrestin-2 isoform X1
  KO
K04439  beta-arrestin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04062  Chemokine signaling pathway
fca04144  Endocytosis
fca04340  Hedgehog signaling pathway
fca04740  Olfactory transduction
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101093558 (ARRB2)
   04340 Hedgehog signaling pathway
    101093558 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101093558 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101093558 (ARRB2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101093558 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    101093558 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    101093558 (ARRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    101093558 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093558 (ARRB2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    101093558 (ARRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C SCA7
Motif
Other DBs
NCBI-GeneID: 101093558
NCBI-ProteinID: XP_023099456
Position
E1
AA seq 495 aa AA seqDB search
MQGRKEEEQVASPEGSGMGRLDAGTGSPLPRLVPSCWKASCPMPHGQSGCPKGQVALLPN
FCLTPGCQEQQLHLGGAECMTTLPAYGPHSSSRRVFKKSSPNCKLTVYLGKRDFVDHLDR
VDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNP
PRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKS
LEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEP
LNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQIEQDDQVSPSSTFCKVYT
ITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVARGG
DVSVELPFVLMHPKPHDHITLPRPQTAAPETDAPVDTNLIEFDTNYATDDDIVFEDFARL
RLKGMKDEDYEDQFC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggcggaaggaggaggagcaggtggccagccccgaggggtcgggtatgggaagg
ctggatgccgggacgggatcccccctccccagactcgtcccgagctgctggaaagcctcc
tgtccaatgccccacgggcagtcgggctgtcccaagggccaggtggctctgcttccaaac
ttctgccttaccccaggttgccaggagcaacagcttcatcttgggggagcggagtgcatg
acgaccctccccgcttatgggcctcactcctcttcccggagggtcttcaagaagtcgagc
cctaactgcaagctcaccgtgtacttgggcaagcgggactttgtagaccacctggacaga
gtagaccccgtagatggcgtggtgctcgtggaccctgactacttgaaggaccgcaaagtg
ttcgtgaccctcacctgcgccttccgctatggccgcgaggacctggacgtgctgggcctg
tccttccgcaaagacctgttcatcgccacctaccaggccttcccccccatgcccaacccg
ccccggccccccacccgccttcaggaccggctgctgaggaagctgggccagcacgcccac
cccttttttttcacaatcccccagaacctgccctgctccgtcacgctgcagccgggccca
gaggacacggggaaggcctgtggagtagactttgagatccgagccttctgtgccaaatca
ctagaagagaaaagccacaaaaggaactctgtgcggctggtgatccgaaaggtgcaattt
gccccagagaaacccggcccccagccctcagcagaaaccacacgccacttcctcatgtct
gaccggtccctgcacctcgaggcttccctggacaaggagctgtactaccacggggagccc
ctgaacgtcaacgtccacgtcaccaacaactccaccaagaccgtcaagaagatcaaagtc
tctgtgagacagtatgccgacatctgcctcttcagcaccgcccagtacaagtgtcctgtg
gctcagatcgaacaagatgaccaggtgtcgcccagttccacgttctgcaaggtatacacc
atcaccccgctgctcagcgacaaccgggagaagcggggtcttgccctggacgggaagctc
aaacacgaggacaccaacctggcttccagcaccatcgtgaaggagggcgccaacaaggag
gtgctgggaatcctggtgtcctacagggtcaaggtgaagctggtggtggctcgtggcggg
gatgtctctgtggagctgccttttgtcctcatgcaccccaagccccacgatcacatcacc
ctccccaggccccagacagctgctcctgagacagacgcccccgtggataccaacctcatt
gaatttgacaccaactacgccacagacgacgacatcgtgttcgaggacttcgcccgcctg
cggctgaaggggatgaaggacgaggattacgaggaccagttctgctag

KEGG   Felis catus (domestic cat): 101101078Help
Entry
101101078         CDS       T02385                                 

Gene name
ARRB1
Definition
(RefSeq) beta-arrestin-1 isoform X3
  KO
K04439  beta-arrestin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04062  Chemokine signaling pathway
fca04144  Endocytosis
fca04340  Hedgehog signaling pathway
fca04740  Olfactory transduction
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101101078 (ARRB1)
   04340 Hedgehog signaling pathway
    101101078 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101101078 (ARRB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101101078 (ARRB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101101078 (ARRB1)
   04928 Parathyroid hormone synthesis, secretion and action
    101101078 (ARRB1)
  09157 Sensory system
   04740 Olfactory transduction
    101101078 (ARRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    101101078 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101078 (ARRB1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    101101078 (ARRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C BatD AP3B1_C LDB19
Motif
Other DBs
NCBI-GeneID: 101101078
NCBI-ProteinID: XP_006936981
Ensembl: ENSFCAG00000011941
Position
D1
AA seq 430 aa AA seqDB search
MASPFLTPALLRSACASFPVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYL
KERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKL
GEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVI
RKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTV
KKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLA
LDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELP
FTLMHPKPKEEPPHREVPENEAPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEED
GTGSPQLNDR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccgttcctgactccagcactcctgcgttctgcctgcgcatctttcccggtg
ttcaagaaggccagcccaaatggaaagctcactgtgtatctgggaaagcgggactttgtg
gaccacatcgacctcgtggaccctgtcgatggtgtggtcctggtggatcctgagtatctc
aaggagaggagagtctatgtgacactgacctgcgccttccgctatggccgggaggacctg
gatgtcctgggcctgacctttcgcaaggacctgtttgtggccaacgtgcagtccttcccg
ccggcccctgaggacaagaagcccctgacacggctgcaggagcgcctcatcaagaagctg
ggcgagcacgcctaccctttcacctttgagatccctccgaacctcccatgctctgtgaca
ttgcagccggggcctgaagacacggggaaggcctgtggtgtggactatgaagtcaaagcc
ttctgtgctgagaacctggaggagaagatccacaagcggaattccgtgcgcctggttatc
aggaaggttcagtatgccccggagaggcctggcccccagcccacagctgagaccaccagg
cagttcctcatgtcggacaagcccctgcatctagaggcctccctggataaggagatctat
taccatggagaacccatcagcgttaatgttcacgtcaccaacaacaccaacaagacagtg
aagaagatcaagatctcggtgcgccagtatgcggacatctgccttttcaacacagcccag
tacaagtgccctgtggccatggaagaggctgatgacacagtggcacccagttcgacattc
tgcaaggtctacacactgacccccttcctggccaacaaccgagagaagcggggcctcgcc
ttggacgggaagctcaagcatgaagacacgaacctggcctccagcaccctgttgagggaa
ggcgccaacagggagatcctgggcatcattgtttcctacaaggtgaaagtgaagctggtg
gtatctcggggcggcctgttgggagatcttgcatccagtgatgtggccgtggaactgccc
ttcaccctaatgcaccccaagcccaaagaggaacccccacatcgtgaagttccagagaac
gaggcgccagtagataccaatctcatagaacttgacacaaacgatgatgacatcgtgttt
gaggactttgcccgccagagactgaaaggcatgaaggacgacaaggaggaagaggaggat
ggtactggttctccacagctcaacgacagatag

DBGET integrated database retrieval system