KEGG   Felis catus (domestic cat): 101093578Help
Entry
101093578         CDS       T02385                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05205  Proteoglycans in cancer
fca05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101093578 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101093578 (HBEGF)
   04915 Estrogen signaling pathway
    101093578 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    101093578 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101093578 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    101093578 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101093578 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101093578 (HBEGF)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   101093578 (HBEGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF
Motif
Other DBs
NCBI-GeneID: 101093578
NCBI-ProteinID: XP_003980879
Ensembl: ENSFCAG00000001273
UniProt: M3VWC1
Position
A1
AA seq 208 aa AA seqDB search
MKLLPSVVLKVFLAAVLSALVTGESLERLRRGLAAGTSNLDSPTESTDQLLPSGGSRGRE
VLDLEETDLDLFRAAFSSKPQPLVTPSKEERGKKKKKGKGLGRKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTVLAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTTSH
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtactgaaggtctttctggctgcagtgctctcggcattg
gtaactggcgagagcctggagcggcttcgaagaggactggcagctggaaccagcaacctg
gactctcccactgaatcaacagaccagctgctgccctcgggaggcagccggggcagggaa
gtcctggacttggaagagacagacctggaccttttcagagctgctttctcctccaagcca
cagcctctggtgacacccagcaaggaggagcgtgggaaaaaaaagaagaaaggcaagggg
ttagggaggaagagagacccatgtcttcggaaatacaaggacttctgcatccacggagag
tgcaaatatgtgaaggagctccgggctccatcctgcatctgccacccaggttaccacgga
gagaggtgccatgggctgagcctcccggtggaaaaccgcttatatacttatgaccatacg
accgtcctggctgtggtggctgtggtgctgtcgtctgtctgtctgcttgtcatcgtgggg
cttctcatgtttcggtaccataggagaggtggttatgatgtggaaaatgaagagaaagtg
aagttgggcatgactacttcccactga

DBGET integrated database retrieval system