KEGG   Felis catus (domestic cat): 101093699Help
Entry
101093699         CDS       T02385                                 

Gene name
MARS
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00450  Selenocompound metabolism
fca00970  Aminoacyl-tRNA biosynthesis
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101093699 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101093699 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fca01007]
    101093699 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fca03016]
    101093699 (MARS)
Enzymes [BR:fca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     101093699 (MARS)
Amino acid related enzymes [BR:fca01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   101093699 (MARS)
Transfer RNA biogenesis [BR:fca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101093699 (MARS)
 Prokaryotic type
   Other AARSs
    101093699 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C GST_C_2 Anticodon_1 GST_N_2 GST_N DUF16
Motif
Other DBs
NCBI-GeneID: 101093699
NCBI-ProteinID: XP_023112936
Ensembl: ENSFCAG00000002083
Position
B4
AA seq 900 aa AA seqDB search
MRLFVSEGAPGSLPVLAAAGRAQGREELLISTVGPSECVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGPVRRA
LTHIDHSLSRRSCPFLAGETESLADIVLWGALYPLLQDPAYLPEELGALHSWFQTLSSQE
PCQRAAETVLKQQGVLALRPYLQKQPLPSSFEGRAVSNEPEEEELVTLSEEEIAMAVTAW
EKGLGSLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHAIHANIYRWFNISFDIFGRTTTP
QQTKITQDIFQRLLTRGFVFQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAIELKKPQCKVCRSCPVVKSSQHLFLDLPKLEKRLEEWLGKTLPGSDWTPNARF
IIRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYVSITANYTDQWERWW
KNPEQVNLYQFMAKDNVPFHGLVFPCSALGAEDNYTLVNHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDMLLKNNSELLNNLGNFINRAGMF
VSKFFGGCVPEMVLTPDDRRLLAHVTLELQHYHQLLEKVRIREALRSILTISRHGNQYIQ
VNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPAPACSI
LLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKAPPKPAVVEAVATAGPQ
QIQVLTDEVTKQGNIVRELKAQKADKNQVAAEVAKLLDLKKQLALAEGKPLETPKGKKKK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttcgtgagcgagggcgccccggggagcttacccgtgctggccgccgcgggc
agggcccagggcagagaggagctgcttatcagcaccgtaggcccatcagagtgtgtggtc
ccgttcctgacccggcctaaggtccctgttttacaactggatagtggcaactacctcttc
tccactagtgcaatctgccgatacttctttttgttatctggctgggagcaagatgacctc
accaaccagtggctggagtgggaagctacggaactgcagccagccttgtctgctgccctg
tactatttagtggtccaaggcaagaagggggaagatgttcttggcccagtccggagagcc
ctgacacacattgaccacagcttgagtcgtcggagctgtcctttcctggctggggagacg
gaatctctagctgacattgttttgtggggagcgctatacccattacttcaagatccagcc
tacctccctgaagagttgggtgccctgcacagctggttccagacactgagttctcaggag
ccatgtcagagagctgcagagactgtgctgaagcagcagggtgtcctggccctccggccc
tacctccaaaagcagcccctccctagctcctttgaggggagggctgtcagcaatgagcct
gaggaggaagaattggttactctgtctgaggaggagattgccatggctgtaactgcttgg
gagaagggcctgggaagcttacccccacttcggccacagcagaatcctgtgttgcctgtg
gctggagaaaggaatgtgctcatcaccagtgccctcccttacgtcaacaatgtcccccac
cttggaaacatcattggttgcgtgctcagtgctgatgtctttgccaggtactcacgcctc
cgccagtggaacaccctctatctgtgtgggacagatgagtacggtacagcgacagagacc
aaggctatggaggagggcctgaccccccaggagatctgtgacaagtaccacgccatccat
gccaacatctatcgctggtttaatatctcatttgatatttttggtcgtaccaccactcca
cagcagaccaaaatcactcaggacatcttccagcggttgttgacccgaggttttgtgttc
caagatactgtggagcagctgcggtgtgagcactgcgcccgcttcctggctgaccgcttt
gtggaaggtgtgtgtcccttctgtggctacgaagaggcccgaggtgaccagtgtgacaag
tgtggcaagctcatcaatgccattgagctcaagaagcctcagtgtaaagtctgccggtcg
tgccctgtggtgaaatcctctcagcacctgttcctggacctgcctaagctggaaaaacga
ctggaggaatggttggggaagacattgcctggcagtgactggacacccaatgcccgattc
atcattcgttcttggcttcgagatggcctcaagccccgctgcataacccgagacctcaaa
tggggaacccctgtacccttagaaggttttgaggacaaggtattctatgtctggtttgat
gccactattggctatgtgtccatcacagccaattatacagaccagtgggagagatggtgg
aagaacccagaacaagtgaacctttatcagttcatggccaaagacaatgttcccttccac
ggcttagtctttccttgttcagccttaggagctgaggacaactataccttggtcaaccac
ctcattgctacagagtacctgaattacgaggatgggaaattctccaagagccggggtgta
ggagtgtttggtgacatggcccaggacacagggatccctgctgacatctggcgcttctat
ctgctatacattcggcctgagggccaggacagtgccttctcctggacagacatgttgctc
aagaataattctgaactgcttaacaacctgggcaacttcatcaacagagctggaatgttt
gtgtctaagttttttgggggctgtgtccccgagatggtgcttactcctgatgatcggcgc
ctgctggcccatgtcactctggagctccagcactatcaccagctgctagagaaggttcgg
atccgggaggccttacgcagtatcctcaccatctctcgccatggcaaccaatacattcag
gtgaatgagccttggaagcggattaaaggcagcgaggctgacaggcagcgggcggggaca
gtgacaggcttggcggtgaatatagctgccttgctgtccgtcatgctccagccttacatg
cccacggttagtgccaccatccaggcccagctgcagcttccagctccagcttgcagcatc
ctcctcacaaacttcctatgtaccttaccagcaggacaccagattggcacggtcagtccc
ttattccaaaaattggaaaatgaccagattgaaagtttgaggcagcgctttggcgggggc
caggcaaaagcaccccccaagccagcagttgtagaggctgtggcaacagctggaccacag
cagatacaagtgctgacagatgaagtgaccaaacagggcaacattgtgcgagaactaaaa
gcacaaaaagcagacaagaaccaggttgccgcagaggtggctaaactcttggatctgaag
aaacagttggctctagctgaggggaaacccctcgaaacccctaaaggcaagaagaaaaag
tga

DBGET integrated database retrieval system