KEGG   Felis catus (domestic cat): 101093740Help
Entry
101093740         CDS       T02385                                 

Gene name
ACSL6
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 6 isoform X3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00061  Fatty acid biosynthesis
fca00071  Fatty acid degradation
fca01100  Metabolic pathways
fca01212  Fatty acid metabolism
fca03320  PPAR signaling pathway
fca04146  Peroxisome
fca04216  Ferroptosis
fca04714  Thermogenesis
fca04920  Adipocytokine signaling pathway
Module
fca_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101093740 (ACSL6)
   00071 Fatty acid degradation
    101093740 (ACSL6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101093740 (ACSL6)
  09143 Cell growth and death
   04216 Ferroptosis
    101093740 (ACSL6)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101093740 (ACSL6)
   03320 PPAR signaling pathway
    101093740 (ACSL6)
  09159 Environmental adaptation
   04714 Thermogenesis
    101093740 (ACSL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fca01004]
    101093740 (ACSL6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101093740 (ACSL6)
Enzymes [BR:fca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101093740 (ACSL6)
Lipid biosynthesis proteins [BR:fca01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101093740 (ACSL6)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101093740 (ACSL6)
  Exosomal proteins of breast cancer cells
   101093740 (ACSL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 101093740
NCBI-ProteinID: XP_011280275
Ensembl: ENSFCAG00000029469
UniProt: A0A337S6X2
Position
A1
AA seq 712 aa AA seqDB search
MSLFSREFILSLLEKMQTQEILRLLRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFT
HRPKALQPPCNLLMQSEEVEDSGGARRSVIGDGPQLLTHYYDDARTMYEVFRRGLSISGN
GPCLGFRKPKQPYQWLSYQEVADRAEYLGSGLLQHNCKACTDQFVGVFAQNRPEWIIAEL
ACYTYSMVVIPLYDTLGPGAIRYIINTADISTVVVDKPQKAVLLLEHVERKETPGLKLII
VMEPFEEALKDRGQECGVVIKSMQAVEECGQRNHHVPVPPKPSDLSIVCFTSGTTGNPKG
AMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQ
GDIRLLSDDMKALCPTIFPVVPRLLNRMYDKIFSQADTPLKRWLLEFAAKRKQAEVRKGI
IRNDSIWDELFFNKIQANLGGCVRMIVTGAAPASPAVLGFLRAALGCQVYEGYGQTECTA
GCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWTYKGEGEICVRGPNVFKGYLKDPDR
TKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYIAPEKIENIYIRSEPVAQ
IFVHGNSLKAYLVGIVVPDPEVMPSWAQKRGIEGSYAELCANKELKKAILEDMVRLGKES
GLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtcactctttagtagagagttcatcctctcgcttctggagaagatgcagacacaagag
atactgaggttgctgcggctgcccgagctgggcgacttgggccagtttttccgcagcctc
tcagccaccacccttgtgagtatgggtgctctggctgccatcctcgcctactggttcact
caccggccaaaggccttacaaccaccatgcaacctcctgatgcagtcagaggaagtggag
gacagtggcggggcccggcgatctgtgattggagatggccctcagctgctcacccactat
tatgatgatgccaggaccatgtacgaggtgttccgccgtgggcttagcatctcagggaat
ggaccctgtcttggcttcaggaagcccaagcaaccttatcagtggctgtcctaccaggag
gtggccgacagggctgaatatctagggtccggacttctgcaacacaattgtaaagcgtgt
acagatcagtttgttggtgtttttgcacaaaatcgaccagagtggatcatcgcagagctt
gcctgctacacgtattctatggtggtgatcccactatatgacaccctgggccctggtgct
atccgctacattatcaacacagctgacatcagcaccgtggtcgtggataaacctcagaag
gctgtgcttctgctagaacatgtggagaggaaggagactccagggctgaagctcatcatt
gtcatggaaccattcgaggaagctctgaaagaccgagggcaggagtgtggggtggtcatt
aagtccatgcaggccgtggaggagtgtggccaacggaatcatcatgtccctgtgcccccg
aagcccagtgacctctccattgtgtgtttcacaagcggcacaacagggaacccaaaaggt
gcgatgctcacccatgggaacgtggtggctgatttctcaggctttctgaaagtgacagag
aaagtgatctttccgagacaggacgatgtgctcatctccttcctgcctttggctcacatg
tttgagagagtaatccagtctgtcgtctactgccatggagggcgcgtaggcttcttccag
ggagatatccgtctcctctcagatgacatgaaggctctgtgccccaccatcttccctgtg
gtccctcgattactgaaccggatgtatgacaagatctttagccaagcagacacaccatta
aagcgctggctcctggagtttgcagcaaagcgtaaacaggctgaggtccgaaagggaatc
atcaggaatgatagcatctgggacgaactcttctttaataagattcaggctaatcttggc
gggtgtgtgcggatgattgttactggagcagccccggcttcaccagcagtcctgggattc
ctccgggcagctctgggatgccaggtttatgaaggctatggccaaactgagtgcacggct
ggatgtaccttcaccacgcctggggactggacctcagggcatgtaggggcacctctgccc
tgcaatcatatcaagctcgtcgatgtcgaggaactgaactattggacctacaaaggagag
ggagagatatgtgtgagaggaccaaatgtgttcaaaggttacttgaaagatccagacagg
acaaaagaggccctggacagtgacggctggcttcatactggggacattgggaaatggctg
ccggcaggaactcttaaaattattgatcggaaaaagcacatatttaaacttgctcagggc
gaatatattgcacccgagaagattgagaacatctacatacggagtgagcctgtggcacaa
atctttgttcacgggaacagcttaaaggcctatttggtgggcattgttgtgcctgaccct
gaagtcatgccctcttgggctcagaagagaggaattgaagggtcatatgcagagctctgt
gcaaataaggagctgaaaaaagccattttggaagatatggtgaggttaggaaaagagagt
ggactccattcgttcgaacaggttaaagccattcacatccactctgacatgttctcagtt
cagaatggcttgctgacaccaacattaaaggctaagagacctgagctgagagagtacttc
aaaaaacaaatagaagagctttactcaatctccatgtga

DBGET integrated database retrieval system