KEGG   Felis catus (domestic cat): 101094153Help
Entry
101094153         CDS       T02385                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor precursor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  Jak-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04650  Natural killer cell mediated cytotoxicity
fca04657  IL-17 signaling pathway
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca05132  Salmonella infection
fca05146  Amoebiasis
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101094153 (CSF2)
   04668 TNF signaling pathway
    101094153 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101094153 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101094153 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    101094153 (CSF2)
   04660 T cell receptor signaling pathway
    101094153 (CSF2)
   04657 IL-17 signaling pathway
    101094153 (CSF2)
   04664 Fc epsilon RI signaling pathway
    101094153 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101094153 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101094153 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101094153 (CSF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101094153 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094153 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101094153 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101094153 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101094153 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101094153 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101094153 (CSF2)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     101094153 (CSF2)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  CSF and other factors
   101094153 (CSF2)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Cytokines
   101094153 (CSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GM_CSF DUF1722
Motif
Other DBs
NCBI-GeneID: 101094153
NCBI-ProteinID: NP_001295966
Ensembl: ENSFCAG00000003852
UniProt: A9UKW3
Position
A1
AA seq 144 aa AA seqDB search
MWLQNLLFLGTVVCSISAPTSSPSSVTRPWQHVDAIKEALSLLNNSSEITAVMNEAVEVV
SEMFDPEEPKCMQTHLKLYEQGLRGSLISLKEPLRMMANHYKQHCPLTPETPCETQTITF
KNFKENLKDFLFNIPFDCWEPDQK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttttcctgggcactgtggtctgcagcatctctgcacccacc
agttcacccagctctgtcactcggccctggcaacacgtggatgccatcaaggaggctctg
agccttctgaacaacagtagtgaaataactgctgtgatgaatgaagcagtagaagtcgtc
tctgaaatgtttgaccctgaggagccgaaatgcatgcagactcacctaaagctgtacgag
cagggcctacggggcagcctcatcagcctcaaggagcctctgagaatgatggccaaccat
tacaagcagcactgcccccttactccggaaacgccctgtgaaacccagactatcaccttc
aaaaatttcaaagagaatctgaaggattttctgtttaacatcccctttgactgctgggag
ccagaccagaagtaa

DBGET integrated database retrieval system