KEGG   Felis catus (domestic cat): 101094441
Entry
101094441         CDS       T02385                                 

Gene name
CDCA7
Definition
(RefSeq) cell division cycle-associated protein 7 isoform X3
  KO
K23408  cell division cycle-associated protein 7
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101094441 (CDCA7)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    101094441 (CDCA7)
SSDB
Motif
Pfam: zf-4CXXC_R1
Other DBs
NCBI-GeneID: 101094441
NCBI-ProteinID: XP_003990922
Ensembl: ENSFCAG00000005476
UniProt: A0A2I2UTQ8
Position
C1
AA seq 372 aa
MDARRVRQKGHGVKKNLKKFRYVKLISMETSSSSDDSCDSFASDNFANTRLQSDHTGCRT
RSQCRRSGPLRVAMKFPTQNTRGAANKRAAPPEPSENSVTDSSSDSEDENGMNFLEKRAL
NIKQNKAMLAKLMSELESFPGSFPGRRSLPGPSSQSKTTRRRTFPGVASRRNPERRARPL
TRSRSRILGSLSALPPEEEEEEEEDKFMLVRKRKTMDNYMNEDDVPRNRRAGSMTLPHII
RPVEEITEEELENICNNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPECWGVRGQFCGP
CLRNRYGEEVKDALLDPNWYCPPCRRICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAY
LKSLKQEFEMQA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggacgctcgccgcgtgcggcaaaagggtcacggagtaaagaagaacttaaagaaattt
agatacgtgaagttgatttccatggaaacctcgtcatcctctgatgacagttgtgacagc
tttgcttctgataattttgcaaacacgagactgcagtcagaccacactggctgcaggacc
cgaagccagtgcagaaggtccggacccctccgcgtggccatgaagtttccaactcagaac
accaggggagccgccaacaagagagcagcacccccagaaccctctgagaattctgtgacc
gattccagttctgattcagaagatgaaaatggcatgaattttttggagaaaagagcttta
aatataaagcaaaacaaagcaatgcttgcaaaactaatgtcagaattagaaagtttccct
ggctcattccctggaaggcgttccctaccaggccccagttcgcagtcaaagacaacccgg
aggcgtacattcccaggtgttgcttccagaagaaaccctgaacggagagctcgtcctctc
accaggtcaaggtctcggatccttgggtcccttagtgctctgcccccagaagaggaggag
gaagaggaggaagataagttcatgttggtgagaaagaggaagaccatggacaactacatg
aatgaagatgacgtgcccagaaatcgtcgtgccggatccatgaccctcccacatataatt
cgccctgtggaagaaattacagaggaagagctggagaacatctgtaacaactctcgagag
aagatctataaccgttcattgggatctacttgccaccaatgccgccagaaaactatcgat
accaaaacaaactgcagaaacccggagtgctggggtgttcgtggccagttctgtggcccc
tgccttcgaaaccgttatggtgaagaagtcaaggatgctctgctggatccaaactggtat
tgtccgccttgccgccgaatctgcaactgcagtttctgtcggcagcgagatgggcggtgt
gcgactggggtccttgtgtatttagccaaataccatggctttggaaacgtgcatgcttac
ttgaaaagtctgaaacaggaattcgaaatgcaagcatag

DBGET integrated database retrieval system