KEGG   Felis catus (domestic cat): 101094681Help
Entry
101094681         CDS       T02385                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X28
  KO
K09052  cAMP response element modulator
Organism
fca  Felis catus (domestic cat)
Pathway
fca04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101094681 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101094681 (CREM)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101094681 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5 Phage_Gp23 DUF4988
Motif
Other DBs
NCBI-GeneID: 101094681
NCBI-ProteinID: XP_003988272
Ensembl: ENSFCAG00000006017
Position
B4
AA seq 113 aa AA seqDB search
MQKPIMAVTGDETAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKREL
RLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagcccatcatggctgtaactggagatgaaacagcagccactggtgacatgcca
acttaccagatccgagctcctactactgctttgccacagggagtagtgatggctgcctca
ccaggaagtttgcacagtccccagcaactagcagaagaagcaacacgcaaacgagagctg
aggctaatgaaaaacagggaagctgcccgggagtgtcgcaggaagaagaaagaatatgtc
aaatgtcttgaaaatcgtgtggctgtgcttgaaaaccaaaacaagactctcattgaggaa
ctcaaggccctcaaagatctttattgccataaagcagagtaa

DBGET integrated database retrieval system