KEGG   Felis catus (domestic cat): 101094772Help
Entry
101094772         CDS       T02385                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04062  Chemokine signaling pathway
fca04144  Endocytosis
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04530  Tight junction
fca04660  T cell receptor signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04912  GnRH signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101094772 (CDC42)
   04015 Rap1 signaling pathway
    101094772 (CDC42)
   04010 MAPK signaling pathway
    101094772 (CDC42)
   04370 VEGF signaling pathway
    101094772 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101094772 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101094772 (CDC42)
   04520 Adherens junction
    101094772 (CDC42)
   04530 Tight junction
    101094772 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101094772 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101094772 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    101094772 (CDC42)
   04670 Leukocyte transendothelial migration
    101094772 (CDC42)
   04062 Chemokine signaling pathway
    101094772 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101094772 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101094772 (CDC42)
  09158 Development
   04360 Axon guidance
    101094772 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094772 (CDC42)
   05205 Proteoglycans in cancer
    101094772 (CDC42)
   05203 Viral carcinogenesis
    101094772 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101094772 (CDC42)
   05211 Renal cell carcinoma
    101094772 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094772 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101094772 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101094772 (CDC42)
   05100 Bacterial invasion of epithelial cells
    101094772 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101094772 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094772 (CDC42)
   03036 Chromosome and associated proteins [BR:fca03036]
    101094772 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094772 (CDC42)
   04031 GTP-binding proteins [BR:fca04031]
    101094772 (CDC42)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101094772 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    101094772 (CDC42)
  Macropinocytosis
   Ras GTPases
    101094772 (CDC42)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101094772 (CDC42)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101094772 (CDC42)
  Exosomal proteins of breast milk
   101094772 (CDC42)
GTP-binding proteins [BR:fca04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101094772 (CDC42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 101094772
NCBI-ProteinID: XP_023114047
Ensembl: ENSFCAG00000004853
Position
C1
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKTRRCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgccgttggtaaaacctgtctcctg
atatcctacacaacaaataaatttccatcggagtatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcatttgaaaatgtgaaggagaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctccga
gatgacccctctacgattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggcggtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgacgaagcgatattggctgccctggagcctcca
gaaccgaagaagacccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system