KEGG   Felis catus (domestic cat): 101094951Help
Entry
101094951         CDS       T02385                                 

Gene name
SPI1
Definition
(RefSeq) transcription factor PU.1 isoform X4
  KO
K09438  transcription factor PU.1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04380  Osteoclast differentiation
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    101094951 (SPI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094951 (SPI1)
   05202 Transcriptional misregulation in cancer
    101094951 (SPI1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101094951 (SPI1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094951 (SPI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101094951 (SPI1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101094951 (SPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 101094951
NCBI-ProteinID: XP_003993289
Ensembl: ENSFCAG00000002531
UniProt: M3VYP4
Position
D1
AA seq 270 aa AA seqDB search
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFTENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMAPTHAGIGHQVSYLPRMCLP
YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLL
RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
VKKVKKKLTYQFSGEVLGRGSLAERRHPPH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctccatcggaagacctg
gttccctatgacacggacctgtaccaacgccagacgcacgaatactacccctatctcagc
agtgatggagaaagccacagcgaccattactgggactttcacccgcaccacgtgcacagc
gagttcgagagcttcaccgagaaccacttcacggagctgcagagcgtgcagcccccccag
ctgcagcagctctaccgccacatggagctggagcagatgcacgtgctcgacacccccatg
gcgccgacccacgcgggcatcggccaccaggtctcctacctaccccggatgtgcctccca
tacccctccttgtccccggcacagcctagctcggatgaggaggagggcgagaggcagagc
cccccgctggaggtgtctgacggggaggctgatggcctggagccagggcctggcctcctg
catggggaaacaggcagcaaaaagaagatccgcctgtaccagttcctgctcgacctgctc
cgcagcggggacatgaaggacagcatctggtgggtggacaaggacaagggcaccttccag
ttctcgtccaagcacaaggaggcgctggcacaccgctggggcatccagaagggaaaccgc
aagaaaatgacctaccagaagatggcccgcgccctgcgcaactatggcaagacgggtgag
gtcaagaaggtcaagaaaaagctcacctaccagttcagcggggaggtgctgggccgcggg
agcctggccgagcggcgccacccgccccactga

DBGET integrated database retrieval system