KEGG   Felis catus (domestic cat): 101094998Help
Entry
101094998         CDS       T02385                                 

Gene name
GARS
Definition
(RefSeq) glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101094998 (GARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fca01007]
    101094998 (GARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fca03016]
    101094998 (GARS)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101094998 (GARS)
Enzymes [BR:fca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     101094998 (GARS)
Amino acid related enzymes [BR:fca01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   101094998 (GARS)
Transfer RNA biogenesis [BR:fca03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    101094998 (GARS)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101094998 (GARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HGTP_anticodon WHEP-TRS tRNA-synt_2b
Motif
Other DBs
NCBI-GeneID: 101094998
NCBI-ProteinID: XP_003982988
Ensembl: ENSFCAG00000011415
Position
A2
AA seq 739 aa AA seqDB search
MPSLRPALLRAARAVLLLSLPSRLPAQLLLRPCRRLSTPARAPTSFPAAASRSSMDGTGA
EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVD
RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDC
TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEME
SVLAQLDNYGQQELGDLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPET
AQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEK
DHPKFQNVADLHLYLYSAKAQVSGQSAKKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKV
GVSPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPL
VAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVLEYLTICEECYITEMEKLLNEKGEF
TIETEGKTFQLTKDMVNVKRFQKTLHVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDE
QRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSSGSIGRRYAR
TDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVCDLANGSITWADVE
ARYPVFEGQETGKKETIEE
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgccctctctgcgcccagcgctgcttagagccgcccgcgccgtgctgctgctgtcgctg
ccgtcccggctcccggcccagcttctgctccggccctgccggcgcctcagcacgcccgcc
cgcgccccgacctcattccccgccgcagcctcccggagcagcatggacggcaccggggct
gaggaggtgctcgcccctctcaggctcgcagtgcgccagcagggagatcttgtacgaaaa
ctgaaagaagataaagcaccccaagtagatgtagacaaagccgtagcagagctcaaagca
cggaagagggtcctggaagcaaaggagctagcattacagcccaaagatgacattgtggac
agagcaaaaatggaagataccctgaagaggagatttttctacgatcaagcttttgctatt
tatggaggcgttagtggtctgtatgattttgggccagttggatgtgctttgaagaacaat
attattcagacctggaggcagcactttatccaagaggagcagatcctagagattgattgt
accatgcttactcctgaaccagttttaaagacctctggccacgtagataaatttgctgac
ttcatggtgaaagatgtaaaaaatggagagtgttttcgcgctgaccatctgttaaaagct
catttacagaaattgatgtctgataagaagtgctctgctgagaagaaatcagagatggaa
agtgtcttggctcagcttgataactatggacagcaagaacttggggatctttttgtgaac
tataatgtaaaatcccccattactggaaatgatctgtcccctccagtatcttttaactta
atgttcaagaccttcattgggcctggaggaaacatgcctgggtacctgagaccagaaact
gcacaggggattttcctgaattttaagagacttttggaattcaaccaaggaaagttgcct
tttgctgctgcccagattggaaattcttttagaaatgagatctcccctcgatctggactg
atcagagtcagagaattcacaatggcagaaattgagcactttgtagatcccagtgagaag
gaccatcccaagttccagaatgtcgcagacctccacctttatttgtattcagcaaaagcc
caggtcagcggacagtctgctaagaaaatgcgcctaggagatgctgttgaacagggtgtg
attaacaactcagtattaggctacttcattggccgcatctacctctacctcacgaaggtt
ggagtatctccagataaactccgcttccgacagcacatggagaatgagatggcccactat
gcctgtgactgttgggatgccgaatctaaaacgtcctatggctggattgagattgtcgga
tgtgctgatcgttcctgttatgacctttcttgtcatgctcgagccaccaaagtcccactt
gtagctgagaaacctctgaaagagcctaaaacagtcaatgttgttcagtttgaacccaat
aagggagccattgggaaggcatataagaaggatgcaaagctggtgctggaataccttacc
atttgtgaggagtgctacattacagagatggaaaaactactgaatgagaaaggggaattc
actattgaaactgaggggaaaacatttcagttaacaaaagacatggtcaacgtgaagaga
ttccagaaaacactacatgtggaagaagttgttccgaatgtaatcgaaccctcctttggc
ctgggcaggatcatgtatacggtatttgaacatacattccatgtacgtgagggagatgaa
cagagaacgttcttcagtttccctgctgtcgtagctccattcaaatgttcggtcctgcca
ctgagccaaaaccaggagttcatgccatttgtcaaggaattatcggaagccctgaccagg
aacggcgtctctcacaaagtagacgactcctctgggtctattggaagacgttatgccagg
actgatgagattggtgtggcttttggcatcaccatcgacttcgatacggtgaacaagacc
cctcacacggcaactctgcgggaccgagactccatgcggcagattagagcagaggtctct
gaactgcccagtgtggtctgcgatctggccaatggcagcatcacgtgggccgatgtggag
gccaggtatcctgtctttgaagggcaagagactggtaaaaaagaaacaatcgaggaatga

DBGET integrated database retrieval system