KEGG   Felis catus (domestic cat): 101095569
Entry
101095569         CDS       T02385                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fca03021]
    101095569 (AFF3)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101095569 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 101095569
NCBI-ProteinID: XP_023107354
Position
A3
AA seq 1251 aa
MDSFDLALLQEWDLESLWGEDILSQRNDSLVVEFQSSASRCRSVYEPDRNVLRRKERERR
NQETQQDDGAFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQAPVNKIDEHFVADSRAQTQPSSVCSTASSTPAAVPVQQSKRGTMGWQKAGHPP
SDGQQRATQGSLRTLLADGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSGHCVQNFP
PSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETSVHCTSYRGVPATKPESTRA
KAKLSKFSIPKQGEESRSGDTNSCVEEIIREMTWLPPLSAVQAPGKVEPSKFPFPNKDSQ
LVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALHALSDSAV
VQQANCRASVPSSKGSSSGSSSGSSSSSSDSESSSGSDSETESSSSESEGSKPPHYSSPE
AEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYYTLAKDEVQDCGKLPDGCQTS
LREKDLKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVTTAAQPPAVPGTPAENAPA
PARRSAGKKPTRRTERTSAGDGANCHRPEEPAAADALGASVVIPPEPAKTRPCGNSRTSH
RKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQAVA
AAAAASGSEQRLKEAANSISGGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELL
SPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLNAPAAKDAESAQPSHPSDTPAEKAL
PKSKRKRKCDNEDDYREVKKAQGEKESSSRLTASANNTLSANHCSMNINSLAIPINKNEK
MLRSPISPLSDASKHKYSSEDLTSSSRSNGNGLFTSASSNKRHKAENQLQAHAGDLTKAA
HNNSENVLHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEAKRMKHKADAMV
EKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATP
EDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTG
TPSPMSPNPSPTSSVGSQGSLSNANTLSPSTIVSIPQRIHQMAANHVSITNSILHSYDYW
EMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gacatcttaagccagaggaatgactctctagttgtggaatttcagtcgtcagccagcaga
tgtaggagcgtctatgaaccagatagaaatgtgttacggaggaaagaacgagaaagaaga
aatcaggaaactcagcaggatgatggcgcatttaattcaagttactcccttttcagtgaa
ccctacaagacgaacaagggagatgagctctccaaccggatccagaatactttaggcaat
tacgatgaaatgaaagactttttaactgatagatctaatcagagtcatctcgttggcgtt
cccaaacctggggttcctcaggctcctgtgaacaagatcgatgaacattttgttgcagat
tcaagagcccagacccagccctcatctgtctgtagcactgcatcttccacaccagcagct
gtccctgtgcagcagagtaagaggggcaccatgggctggcagaaggctgggcacccacca
tcagatggccaacagagagcaacacaaggctctctcaggaccttgcttgcagatggtgtt
ggcagacagcagccacgagccaagcaagtgtgcaatgtagaggtggggcttcagacccag
gaaaggccacctgctatggcagccaagcacagcagcggacactgtgttcagaactttcct
ccatccctggcttcaaaacccagcctggttcagcagaaaccaactgcatatgtgcggccg
atggacggccaagatcaggctcctgatgagtctccaaagcttaagtcatccacagaaacc
agtgtgcactgtacgtcatacaggggagtcccggccaccaagccagagtccaccagagcc
aaggccaagctgtccaagttcagcatccccaagcaaggagaggagagtagatctggagac
acaaacagctgtgttgaagaaataattcgggagatgacctggctcccaccactttctgct
gttcaagcacctggcaaagtggaaccaagcaaatttccatttccaaataaggactctcag
cttgtttcctctggacacaataatccaaagaaaggtgatgctgagccagagagtcctgac
aatggcacatcgaatacatcaatgctagaagatgaccttaagctaagtagtgatgaagag
gagaatgaacagcaggcagcccagagaactgctctccacgctctgtctgacagcgccgtg
gtccagcaggccaactgcagagcctctgtgccttccagcaagggcagcagcagcggcagc
agcagcggcagcagcagctcctccagtgactcagagagcagctcgggatctgactcggag
acggagagcagttccagcgagagtgagggcagcaagcctccccactactccagccccgag
gccgaaccagcgtcctctaacaagtggcagctggataaatggctgaacaaagttaatccc
cacaagccgcctatcctgatccaaaatgaaagccacgggccagagagcaatcaatactac
accctggccaaagacgaagtgcaggactgtgggaaacttcccgacggttgccaaaccagc
ctgagagagaaggacctcaagagcacctgcaaggaggagcagaggccgaggacagcgaac
aaggccccggggagcaaaggagtgaagcagaagtctccgcctgcggccgtggccgtggcc
gtgaccacagcggcccagccgcccgctgtacccggcacacccgccgagaacgcccccgcg
cctgcgcggaggtctgcgggcaagaagcccaccaggcgcacggagaggacctctgccggc
gacggtgccaactgccaccggcccgaggagccggcagccgccgacgcgctgggggcaagc
gtggtgattcccccggagcccgccaaaaccaggccctgcggcaacagcagaacgagccac
cgcaaggagctgcgctcctccgtgacctgcgagaagcgccgcacgcgggggctgagccgc
atcgtccccaaatccaaggagttcatagagacagagtcgtcgtcttcgtcctcctcctcg
gactcagacctggaatcggagcaggaggaataccctctgtccaaagcgcaggccgtggcc
gccgcagccgccgcctcggggagtgagcagagactaaaggaggctgccaacagcatcagc
ggcggtgggggcccccgggcccccgtaggctccatcaacgccaggaccaccagtgacatt
gccaaggagctggaggagcagttctacacactggtccctttcggccggaatgaacttctc
tcccccttgaaggacagtgatgaggtcaggtctctctgggtcaaaattgacctgaccctc
ctgtccaggatcccagaacacctgccccaggagccgggggtcttgaatgctcctgcagcc
aaggacgctgagagtgcacagcccagccatccatctgacactcctgccgaaaaggctttg
ccaaaatccaagaggaaacgcaagtgtgacaacgaagatgactatagggaggtcaagaag
gcccagggagagaaagagagctcttcacgactgactgcctctgccaataatactttatcc
gcaaaccactgcagcatgaacatcaacagcttggcaataccaataaataaaaatgaaaaa
atgctccggtcacccatctcgcccctgtctgatgcatctaaacacaaatactccagcgag
gacttaacttcttccagcagatcaaatggcaacggtttgttcacttccgcctcctccaac
aaaaggcataaggctgagaaccagctgcaggctcatgccggagacctcacaaaagccgct
cacaacaattccgaaaacgttctccacaagtcacggccacaaacagagccatggtctcca
ggttccaacggccacagggactgcaagaggcagaaacttatcttcgatgatatgccacgc
agtgcagattattttatgcaggaagctaaacggatgaagcataaagcagatgcaatggtg
gaaaagtttggaaaggctttgaattatgctgaagcagctttgtcatttattgagtgtgga
aatgcaatggaacaaggcccaatggaatccaaatctccctatacaatgtattcggaaaca
gtagagctcatcaggtatgctatgagactaaaaacccattcaggccctaatgccacacca
gaagacaaacaattggctgcattatgttatcgatgcctggctctcctgtactggcggatg
tttcgactcaaaagggaccacgctgtgaagtactcaaaagcacttatcgactatttcaag
aattcatctaaagctgcccaagccccatctccatggggagccagtggaaagagcactgga
accccatcccccatgtctcccaacccctctccgaccagctccgtgggatctcaggggagc
ctctccaatgccaacaccctgtccccttccaccatcgtcagcatcccacagcgcatccac
cagatggcagccaaccacgtcagcatcaccaacagcattctccacagctatgactactgg
gagatggcggacaacctggccaaggaaaacagagaattcttcaacgacctggatttgctc
atggggcctgtcaccctgcacagcagcatggagcacctggtccaatactcccagcagggc
ctgcactggctgcggaacagcacccacctgtcatag

DBGET integrated database retrieval system