KEGG   Felis catus (domestic cat): 101095575Help
Entry
101095575         CDS       T02385                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00232  Caffeine metabolism
fca00983  Drug metabolism - other enzymes
fca01100  Metabolic pathways
fca05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    101095575
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101095575
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101095575
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     101095575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 101095575
NCBI-ProteinID: XP_004001642
UniProt: A0A2I2V0H2
Position
B1
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNSRNKLDLETLTDILQHQIRAIPFENLNIHCGETMELGLKAIFEQVV
WRNRGGWCLQVNHLLYWVLTTIGYETTMLGGYVYSTAANKYSNAMIHLLLKVTTEGKNYI
VDAGFGRSYQMWQPLELISGKDQLQVPCIFRLTEERGIWYLDQIRRQQYIANEEFLNSDL
LEKNKYRKIYSFTLEPRTIEDFESVNTYLQTSPTSVFTSKSFCSLQTSEGVHCLVGCTLT
YRKFNYKDNMDLVEFKVLNEEEVEQKLKNIFNISLERKFVPKHGDQFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatattttgaaagaattggttataagaattctaggaacaaattggac
ttggaaacattaactgacattcttcagcaccagatccgagccattccctttgagaacctt
aacatccattgtggggaaaccatggaattgggcttgaaggccatttttgagcaagttgtg
tggaggaaccgtggtggatggtgtctccaggtcaatcatcttctgtactgggttctgacc
acaattggttatgagaccacaatgttggggggttatgtgtacagtactgcagccaacaaa
tatagtaatgctatgattcatctcctgctgaaggtgactactgagggtaagaattacata
gtggatgctggatttggacgttcttaccagatgtggcagcctctggagttaatttctgga
aaggatcagcttcaagtgccttgcatcttccgcttgacagaagagagaggaatctggtac
ctggaccaaatcagaagacagcagtacattgcaaatgaagaatttcttaattctgatctc
ctggaaaaaaataaataccgaaaaatatactcctttactcttgaacctcgaacaattgaa
gattttgagtctgtgaatacataccttcagacatctccaacatctgtgtttacaagcaag
tcattctgttccttgcagacatctgaaggggttcactgtttagtgggctgcacccttacc
tataggaaattcaattataaggacaatatggatttggtagagtttaaggtcctgaatgaa
gaagaagtagaacaaaagctgaaaaatatatttaatatttccttagagagaaagtttgtg
cccaaacatggtgatcaattttttaccatttag

DBGET integrated database retrieval system