KEGG   Felis catus (domestic cat): 101095782Help
Entry
101095782         CDS       T02385                                 

Gene name
CBLC
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-C isoform X1
  KO
K22518  E3 ubiquitin-protein ligase CBL-C [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04120  Ubiquitin mediated proteolysis
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101095782 (CBLC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101095782 (CBLC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095782 (CBLC)
   04121 Ubiquitin system [BR:fca04121]
    101095782 (CBLC)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101095782 (CBLC)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101095782 (CBLC)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101095782 (CBLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N3 Cbl_N Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX zf-RING_4 SH2 zf-rbx1 Rtf2
Motif
Other DBs
NCBI-GeneID: 101095782
NCBI-ProteinID: XP_023101140
Position
E2
AA seq 494 aa AA seqDB search
MAAVAAPWGRQREEARALGRAVRLLERLEEHFGDPRLASSPPSMRDLLPRTAQLLREVAH
ARRAADGGGPERPGGARDFLVVYLNNLEAKSRQVAALLAPQGRRSANDELFREGSGLRRQ
LAKLALIFRYMHAELSALFPGGKYCGHTYQLAKAPAHSFWRGHCGARCVLTWAEFESILC
TCHPVESGSTGLALRSTINLTGSGHVSIFEFDIFTRLFQPWPTLLKNWQLLAVNHPGYVA
FLTYNEVQARLQACRDKPGSYIFRPSCTHLGQWAIGFVNSDGSILQTISLNKPLFQTLLD
GQREGLFLYPDGKNHNPDLTELCQMEPHQRIHVSEEQLKLYWAMDSTFELCKICTERDKD
VKIKPCGHLLCGSCLATWQNFESQTCPFCRGEIKGQEAVSIHQFQEKPEEATAAAEYLRS
SSDQEDGEEELGQVVSSAPPQLNVSPATGRLKMVPLALPRLQGPLPLPRIKTVALAPWEI
TSNPQAREGATGNS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggtggcagccccctgggggcggcagcgggaagaggcccgcgcgctcggccgg
gcggtgaggctgctggaacgcctggaagagcacttcggggacccccggcttgcctccagt
cccccctcgatgcgggacctgctgccccgcaccgcgcagctgctgcgcgaggtggcccac
gcccggcgggcggccgacggaggcggccccgagcgtcccggcggtgcgcgggacttcctc
gtcgtctaccttaacaacctggaggccaagagcaggcaggtggcggcactgctggcaccc
cagggtcggaggagtgccaatgacgagctcttccgggagggctccggactcaggcgacag
ctggccaagctggccctcatattccgctacatgcatgcggaactgagcgcactcttcccc
ggcggaaagtactgtggacacacgtaccagctcgccaaggccccagcccacagcttctgg
agggggcactgcggcgcccgttgtgtcctgacctgggctgagtttgagtccatcttgtgc
acctgccacccggtggaatctggctccacgggcctggccttgcgctccaccatcaacctc
actggcagcggccacgtgtccatcttcgagtttgacatctttaccaggctcttccagcct
tggccgacactcctcaagaactggcagctcctggcggtcaaccacccgggctacgtggcc
ttcctcacgtacaatgaggttcaagcgcgtctgcaggcctgcagagacaagccaggcagc
tacatcttccggcccagctgcactcacctgggacaatgggccattggattcgtgaactca
gacggcagcatcctgcagaccatttctctcaacaagcccctgttccagacactcctggac
ggacaaagggaaggcctcttcctctacccagatgggaagaaccacaacccagacctgact
gaactctgccagatggagccccatcagcgcatccatgtgtcggaggagcagctgaagctg
tactgggccatggactccacgtttgagctctgcaagatctgtaccgagagggacaaggac
gtgaagatcaagccatgtggacacctgctctgtggcagctgcctggctacctggcagaac
tttgaaagccagacgtgccccttctgccgcggcgagatcaagggccaagaggccgtgagt
atccatcaatttcaagagaagccagaggaagccacggccgctgccgagtacctgaggtcc
agcagtgaccaggaagatggggaggaggagctggggcaggtggtttcctcggccccccct
cagctgaatgtgtccccagctacgggccggctgaaaatggtacctctggccctccccaga
cttcagggccctctacccttgccaagaattaagactgtggccttagccccatgggaaatc
acctccaaccctcaggccagggagggagccacaggaaactcctaa

KEGG   Felis catus (domestic cat): 101096508Help
Entry
101096508         CDS       T02385                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04144  Endocytosis
fca04910  Insulin signaling pathway
fca05100  Bacterial invasion of epithelial cells
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101096508
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101096508
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101096508
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101096508
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101096508
   05205 Proteoglycans in cancer
    101096508
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101096508
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101096508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096508
   04121 Ubiquitin system [BR:fca04121]
    101096508
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101096508
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101096508
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101096508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N3 Cbl_N2 Cbl_N Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 101096508
NCBI-ProteinID: XP_023094948
Ensembl: ENSFCAG00000004737
Position
D1
AA seq 805 aa AA seqDB search
METLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAEL
KGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALK
STIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFI
HKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQ
NPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCL
TSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADD
SLFMMKELAGAKVERPPSPFSVAPQASLPPVPPRLDLLQQRVSIPSSASGLGSASKAASG
SLHKDKPLPIPPTLRDLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSR
LGESWLPRPIPKVPVVAPNAGDPWTGRELTNRHSLPFSLPSQMEPRTDVPRLGSTFSVDT
SVNMNNSPLAGSEFEHPKIKPSASASAIYSLAARPLPVPKLPPGEQGESEEDTEYMTPSS
RPLGLPKPDGKWPLDTTQSSRACDCDQQIDSCTYEAMYNIQSQAAPAVTESSTFGEGNLA
PAHASTGPEESENEEDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLEGDPTANFTEG
SQVPERPPKPFPRRINSERKAGSCQQGGAAPAPPQLSSEIENLMSQGYSYQDIQKALVIA
HNNIEMAKNILREFVSISSPAHVAT
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggagacacttggagaaaatgagtattttagggtgttcatggagaatttgatgaagaaa
actaagcagaccataagcctcttcaaggaggggaaagaaagaatgtatgaggagaattct
cagcctaggcgaaacctaaccaaactgtcactgatcttcagccacatgctggcggaacta
aaaggaatctttccaagtggactctttcaaggagacacatttcggattacgaaagcagac
gctgcagaattttggaggaaagcttttggggaaaagacaatagtcccttggaagagtttc
cgacaggcccttcacgaagtgcatcccatcagttccgggctcgaggccatggctctgaaa
tccactattgatctgacctgcaatgattatatttcagtttttgaatttgacatctttaca
agactctttcagccgtggtcctctttgctcaggaactggaacagtcttgctgtaactcat
cccggatacatggctttcctgacgtatgatgaagtaaaagctcggctccagaagttcatt
cacaaacccggaagttacattttccggctcagctgcactcgtctgggtcagtgggctatt
gggtacgtcactgctgacgggaacattctccagacaatcccacacaataaacctctcttt
caagccctgattgacggcttcagggaaggcttctatctgtttccagatggacggaatcag
aatcctgacctgacaggcttgtgtgaaccaactccccaagaccacatcaaagtgacccag
gaacaatatgaattatactgtgagatgggctccacattccaactgtgtaaaatatgtgct
gaaaatgataaggatgtaaaaatcgagccctgtggacacctcatgtgcacgtcctgtctt
acgtcctggcaggaatcagaaggccagggctgtcctttctgccgatgtgaaattaaaggt
actgagcccatcgtggtagatccgtttgaccctagaggaagtggcagcctgctgaggcaa
ggagccgagggagctccctccccaaattatgatgacgatgacgacgaacgagcggatgat
tctctctttatgatgaaggaattggctggtgccaaggtggaacggcctccctctccattt
tcagtggccccgcaagcctcccttcccccggtgccaccgcgacttgaccttctgcaacag
cgggtgtctattccttcaagtgcttctgggcttggaagtgcttctaaggcagcttctggc
tctcttcataaggacaaaccattaccgatacctcccacacttcgagatcttccaccaccg
ccccctccagaccggccatactctgttggagcagaaagccggcctcagagacgccccttg
ccttgcacaccaggcgactgtccgtccagggacaaactgccccctgttccctctagccgc
cttggggaatcatggctgcctcggccgatccccaaagtaccagtggtcgctccaaacgct
ggtgacccctggacaggtagagaattaaccaaccggcactcacttccattttcattgccc
tcacaaatggagcccagaacagatgtgcctaggcttggaagcacattcagtgtggatacc
tccgtgaatatgaataacagcccattagcaggttcagagtttgagcaccccaaaatcaaa
ccttctgcgtctgccagtgccatttattctctggctgccaggcctcttcctgtgccaaag
ctgccccccggggagcagggtgaaagtgaggaggacacggagtatatgaccccctcctcc
aggcctctaggacttccaaaaccggatgggaaatggcctttggacacaacccagagttca
cgagcgtgtgattgtgaccagcagattgatagctgtacatatgaagcaatgtataatatt
cagtcccaggcggcaccggctgtcacagagagcagcacctttggtgaagggaatctggcc
ccggcccacgccagcaccggacccgaggagtctgaaaatgaggaggatggctatgacgtc
cccaagccgcctgtgccggcagtgctggcccggcggactctgtccgacatctctaacgcc
agctcttcgttcggctggttgtctctggaaggcgaccccactgcaaacttcactgagggt
tcccaagttcccgaaaggcctcccaaaccgttccctcggagaatcaactctgaacgaaaa
gcaggtagctgtcagcaaggcggtgccgcccccgccccaccgcagctctccagtgagatt
gagaacctcatgagtcagggatactcctaccaggacattcagaaagctttggtcattgcc
cacaacaacatcgaaatggccaaaaatatcctccgggaatttgtttctatttcttctccc
gcccacgtcgccacctag

KEGG   Felis catus (domestic cat): 101101498Help
Entry
101101498         CDS       T02385                                 

Gene name
CBLB
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B isoform X1
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04144  Endocytosis
fca04625  C-type lectin receptor signaling pathway
fca04660  T cell receptor signaling pathway
fca04910  Insulin signaling pathway
fca05162  Measles
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101101498 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101101498 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101101498 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101101498 (CBLB)
   04660 T cell receptor signaling pathway
    101101498 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101101498 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    101101498 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101498 (CBLB)
   04121 Ubiquitin system [BR:fca04121]
    101101498 (CBLB)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101101498 (CBLB)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101101498 (CBLB)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101101498 (CBLB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-rbx1 UBA zf-RING_4
Motif
Other DBs
NCBI-GeneID: 101101498
NCBI-ProteinID: XP_006936081
Ensembl: ENSFCAG00000004555
UniProt: M3W2E6
Position
C2
AA seq 984 aa AA seqDB search
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGVPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPHPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFHHVESVPSRDQPMPLEAWCPRDVFG
SNQSVVGCRLLGDGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGH
LGSEEYDVPPRLSPPPPAAALLPSIKCTGPLANSLSEKTRDPVEEDDDEYKVPSSHPVSL
NSQPSHCHNVKPPLRSCDNGHCILNGTHGTSSEMKKPNIPELGIYLKGDVFDSASDPVPL
PPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKP
PGSNSRPSSGQDLFLLPSDPFLDPASGQVPLPPARRLPGENVKANRASQDYDPLPSSSDG
SQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQN
NVEVARSILREFAFPPPVSPRLNL
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattctatgaatggcagaaaccctggtggtcgaggaggaaacccccgaaaagga
agaattttgggaattattgatgctattcaagatgcagttggacctcccaagcaagcagca
gcagatcgcaggactgtggagaaaacttggaaactcatggacaaagtggtcagactgtgc
caaaatcccaaacttcagttgaaaaatagcccaccatacatacttgatattttacctgat
acatatcaacatttgcgacttatattgagtaaatatgatgacaaccaaaaacttgcccaa
ctcagtgagaatgagtattttaaaatctacattgacagtttaatgaaaaagtcaaaacgg
gcaataagactctttaaagaaggcaaggagaggatgtacgaagagcagtcacaggacaga
cgaaatctcaccaaactgtcccttatcttcagtcatatgctggcagaaattaaagcaatc
tttcctaatgggcaattccagggagataactttcgtatcacgaaagcagacgctgctgag
ttctggagaaagttttttggagacaagactattgtgccatggaaagtattcagacagtgc
cttcatgaggttcatcaaattagctccggcctggaagcaatggctctgaaatcaacaatt
gatttaacttgtaatgattacatttcagtttttgaatttgatatttttaccagactcttt
cagccttggggctctattttacggaattggaatttcttagctgtaacacatccaggttac
atggcatttctcacatatgatgaagttaaagcacgactacagaaatacagcaccaaaccc
ggaagctacattttccggttaagctgcactagattgggacagtgggccattggctatgtg
acaggggatggcaatatcttacagaccataccgcataacaagcccttatttcaagccctg
attgacggcagcagggaaggattctatctttatcctgatgggaggagctataatcctgat
ttaactggattgtgtgaacctacaccccatgatcatataaaagttacccaggaacaatat
gaattatattgtgaaatgggctccacttttcagctttgtaaaatttgtgctgagaacgac
aaagatgtcaagattgagccttgtgggcatttgatgtgcacctcttgccttacagcatgg
caggagtcagatggccagggctgccccttctgtcgctgtgaaataaaaggaacagagccc
atcatcgtcgacccctttgatccaagggacgaaggttccaggtgctgtagcatcattgac
ccctttggagtgccgatgctggacctggatgatgatgatgaccgagaggagtccttgatg
atgaatcggttggcaaatgttcgaaagtgcactgacaggcagaattcaccagttacatca
ccaggatcctctccccttgcacagagaagaaagccgcatccagatcctctccagatccca
catctaagcctgccaccagtgcctcctcgcctggacttaattcagaaaggcatagttcgg
tctccctgtggcagccccactggttcaccaaagtcttctccttgcatggtgagaaagcaa
gataaaccactccccgcacctcctcctcccttacgagatcctcctccgcctccacctgag
agacctcccccaatcccacctgacaatagactgagtcgtcacttccatcacgtggaaagt
gtgccttctagagaccagccaatgcctcttgaagcctggtgccctcgggatgtgtttggg
agtaatcagtcggtggtgggatgtcgactcttaggggatggctctccaaagcctggaatc
acagcaagttcaaatgtgaatggaagacacagtagagtgggctctgaccccgtgcttatg
cggaaacacagacgccatgatttgcctttagaaggagccaaggtcttttccaatggtcac
ctgggaagtgaagaatatgatgttcctccccggctttctcctcctcctccagctgctgcc
cttctccctagcatcaagtgtactggcccgttagcaaattccctttcagagaaaaccaga
gacccagtagaggaagatgacgatgaatacaaggttccttcatcccatcctgtttccctg
aattcacaaccatctcattgccataacgtaaaacctcctcttaggtcctgtgataatggt
cattgtatattgaatggaacacatggtacatcttcagagatgaagaaaccaaacatccct
gaattaggcatatatttaaagggagatgtttttgattcagcctctgatccagtgccatta
ccacctgccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacg
ccctctgattatgatcttctcatccctccattaggtgaagatgcttttgatgccctcccc
ccatccctgccacctcccccaccgcctgcaaggcacagcctcatcgaacactcaaaacct
cctggctccaatagccgaccatcctcaggacaggaccttttccttcttccttcagatccc
tttcttgatccagcaagtggccaagttcctttgcctcctgctaggagattaccaggcgaa
aatgtcaaagccaacagagcatcacaggactatgatccgcttccttcatcttcagatggt
tcacaagcaccagccagacctcctaaaccacgaccccgcaggactgcaccagaaatccac
cacagaaaaccccatgggcccgaggcagcattggaaaatgttgatgcgaaaattgcaaaa
ctcatgggagagggttatgcctttgaagaagtgaagagagccttagagatagctcagaat
aacgtcgaagtggcgcgtagcatcctccgagaatttgccttcccgcctccagtctctcca
cgtctaaatctatag

KEGG   Felis catus (domestic cat): 111556576Help
Entry
111556576         CDS       T02385                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-like
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04144  Endocytosis
fca04910  Insulin signaling pathway
fca05100  Bacterial invasion of epithelial cells
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111556576
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111556576
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111556576
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111556576
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111556576
   05205 Proteoglycans in cancer
    111556576
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111556576
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111556576
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    111556576
   04121 Ubiquitin system [BR:fca04121]
    111556576
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     111556576
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    111556576
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    111556576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N
Motif
Other DBs
NCBI-GeneID: 111556576
NCBI-ProteinID: XP_023094949
Position
D1
AA seq 148 aa AA seqDB search
MAGNVKKSSGAGGGGSSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaacgtgaaaaagagctctggggccgggggcggcggcagctccgggggctcg
ggctcgggcggcctgatcgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccacctcagcccccacccgcccggcaccgtggacaagaagatggtggagaagtgctgg
aagctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagc
ccaccttatatcttagacctgctgccagatacctaccagcatctgcgcactatcttgtca
agatatgaggggaagatggagacacttggagaaaatgagtattttagggtgttcatggag
aatttgatgaagaaaactaagcagaccataagcctcttcaaggaggggaaagaaagaatg
tatgaggagaattctcagcctaggtaa

DBGET integrated database retrieval system