KEGG   Felis catus (domestic cat): 101095899Help
Entry
101095899         CDS       T02385                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7 isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04140  Autophagy - animal
fca04152  AMPK signaling pathway
fca04310  Wnt signaling pathway
fca04380  Osteoclast differentiation
fca04520  Adherens junction
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04660  T cell receptor signaling pathway
fca04668  TNF signaling pathway
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05161  Hepatitis B
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00686  Toll-like receptor signaling
fca_M00688  MAPK (JNK) signaling
fca_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101095899 (MAP3K7)
   04310 Wnt signaling pathway
    101095899 (MAP3K7)
   04064 NF-kappa B signaling pathway
    101095899 (MAP3K7)
   04668 TNF signaling pathway
    101095899 (MAP3K7)
   04152 AMPK signaling pathway
    101095899 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101095899 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101095899 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101095899 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    101095899 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    101095899 (MAP3K7)
   04660 T cell receptor signaling pathway
    101095899 (MAP3K7)
   04657 IL-17 signaling pathway
    101095899 (MAP3K7)
  09158 Development
   04380 Osteoclast differentiation
    101095899 (MAP3K7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101095899 (MAP3K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101095899 (MAP3K7)
   05162 Measles
    101095899 (MAP3K7)
   05161 Hepatitis B
    101095899 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    101095899 (MAP3K7)
   05169 Epstein-Barr virus infection
    101095899 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101095899 (MAP3K7)
   05140 Leishmaniasis
    101095899 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095899 (MAP3K7)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101095899 (MAP3K7)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  MLK family
   101095899 (MAP3K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 101095899
NCBI-ProteinID: XP_003986428
Ensembl: ENSFCAG00000030907
UniProt: M3WSG5
Position
B2
AA seq 606 aa AA seqDB search
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQIPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPSRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcctccgccgcttcctcctcttcctcatcttcggccggtgagatgatcgaa
gccccctcccaagtcctcaactttgaagagattgactacaaggagatcgaagtggaagag
gttgttggaagaggagcctttggagtagtctgcaaagctaaatggagagcaaaagatgtt
gccatcaaacaaatagaaagtgaatctgagaggaaagcttttattgtagagcttcgacag
ttatcccgcgtgaaccatcctaatattgtaaagctgtatggggcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattacactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagctctaattcacagggacctgaaaccacca
aacttgttgctggttgcaggggggacagttttaaaaatctgtgactttggtacagcctgt
gacattcagacacacatgaccaataacaagggcagtgctgcttggatggcacctgaagtt
tttgaaggtagcaattacagtgaaaaatgtgacgtcttcagctggggtattatcctttgg
gaagtaataacacgtcggaaaccctttgatgagattggtggcccagctttccgtatcatg
tgggctgttcataatggtactcgaccaccactgatcaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttctcagcgcccttcaatggaggagatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtactcagatgaaggacagagcaattctgccaccagtacaggctcattcatg
gacatcgcttctacaaataccagtaataaaagtgacactaatatggagcaaattcctgca
acaaatgatactattaaacgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatcgggacgtttaagcctgggagcttcccgtgggagcagcgtggagagcttgccc
cccacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagccaggattgct
gcgacaacagcctattccaagcctaaacggggccaccgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtaggtccatc
caagacttgactgttactggaacagaacctggtcaggtaagcagtaggtcatccagtcct
agtgtcagaatgatcactacctcaggaccaacctcagaaaagccaagtcgaagtcatcca
tggactcctgatgattccacagataccaatggatcggataactccatcccaatggcttat
cttacactggatcaccagctacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgagcagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgtctggtgcaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttattaccagcaatgtaaaaaacaactagaggtcatcagaagccagcagcaa
aaacgacaaggcacttcatga

DBGET integrated database retrieval system