KEGG   Felis catus (domestic cat): 101095952Help
Entry
101095952         CDS       T02385                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04062  Chemokine signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05205  Proteoglycans in cancer
fca05222  Small cell lung cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101095952 (PTK2)
   04370 VEGF signaling pathway
    101095952 (PTK2)
   04151 PI3K-Akt signaling pathway
    101095952 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101095952 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101095952 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101095952 (PTK2)
   04062 Chemokine signaling pathway
    101095952 (PTK2)
  09158 Development
   04360 Axon guidance
    101095952 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095952 (PTK2)
   05202 Transcriptional misregulation in cancer
    101095952 (PTK2)
   05205 Proteoglycans in cancer
    101095952 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101095952 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101095952 (PTK2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101095952 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101095952 (PTK2)
   05163 Human cytomegalovirus infection
    101095952 (PTK2)
   05165 Human papillomavirus infection
    101095952 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101095952 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101095952 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095952 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101095952 (PTK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101095952 (PTK2)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  FAK family
   101095952 (PTK2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101095952 (PTK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_N_2 FERM_M Haspin_kinase FERM_F2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 101095952
NCBI-ProteinID: XP_023104388
Ensembl: ENSFCAG00000014619
Position
F2
AA seq 1155 aa AA seqDB search
MLVELAGREALRPAGAVCMEKSGCGPFPMCWAKDYDRYIAPSKIMAAAYLDPNLNHTPNS
STKTHLGTGVERSPGAMERVLKVFHYFENSSEPATWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMSEIADRVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCSPTHLADFNQVQTIQYSNSEDKDRKGTL
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANSEKQGVRTHAVSVSGIYPDVTHSAARALTWASRSVSSLGALATSPSPLTLLSPCPTSL
LLETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQGVYMS
PENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLVGVITENPVWIIMELCT
LGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLG
DFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF
QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEE
KVQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQ
VSGYPGSHGVTATAGSIYPGQASLLDQTDSWNHRPQEISMWQPNVEDSAALDLRGIGQVL
PTQLVEERLIRQQQEMEEDQRWLEKEERFLVILKPDVRLSRGSIDREDGSLQGPTGNQHI
YQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPGDSYNEGVKPWRLQPQEISPPPTANL
DRSNDRVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETLPVLPA
STHREIEMAQKLLNSDLGELINKMKLAQRCAMTSLQQDHKKQMLTAAHALAVDAKNLLDV
IDQARLRALGHARPR
NT seq 3468 nt NT seq  +upstreamnt  +downstreamnt
atgttggtggaactggcgggccgagaggccctgagaccagcaggtgccgtctgtatggag
aagagcggctgtggtccatttccaatgtgttgggctaaagattatgacagatacatagca
ccaagcaaaataatggcagctgcttaccttgacccaaacttgaatcacaccccgaattcg
agtaccaagacccatctgggtaccggagtggaacgttcccccggggcaatggagcgagtg
ttgaaggtctttcattattttgagaacagcagtgagccagccacttgggccagtattatc
aggcacggagatgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggatttcgtctcagtcacctgcggtcagaggaggttcac
tggctccatttggatatgggtgtctccaatgtgagggagaagtatgaacttgcacaccca
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagacaagccaactctgaatttcttctatcaacaggtgaaaagtgactacatg
tcggagatagctgaccgggtggaccaggacatcgctttgaagctgggctgcctagaaata
cggcgctcgtattgggagatgcgaggcaacgcgctagagaagaagtccaactatgaggtg
ttagaaaaagatgttggtttgaagcgattttttcctaggagtttactggattctgtcaag
gccaaaacactaagaaaactgatccaacagacgtttagacagttcgccaacctgaacaga
gaagagagcattctgaaattctttgagatcctctccccagtgtaccgatttgataaagag
tgcttcaagtgtgccctcggttcaagctggattatttcagtggaactggcgatcggccca
gaagaaggaatcagttacctcacggacaagggctgcagccccacacatctggccgacttc
aatcaagtgcagaccattcagtattccaacagcgaagacaaggacaggaaaggaacgctg
cagctgaaaatcgcgggcgcccccgagcctctgacagtgacagcaccgtccctgaccatc
gccgagaatatggctgacctgatagatgggtactgccggctggtgaacggagccacgcag
tcctttatcatcaggccccagaaagaaggtgaacgggctttgccatcaataccaaagctg
gccaacagcgagaagcaaggcgtgcggacacacgcggtctccgtgtcaggcatctaccct
gacgtcactcacagtgcagccagagccctgacgtgggcttctaggtctgtgtcatcactg
ggagcattggccacctctccctcacccctcactcttttgtcaccctgcccaacctcattg
ctcctcgaaaccgacgactatgctgagattatagacgaagaagatacctacaccatgccc
tcaaaaagctatggaatagacgaagccagggactacgagatccaaagagaaagaatcgag
cttggacggtgcatcggggaaggccagtttggggacgtccaccaaggcgtctacatgagt
ccagagaatccggctttggcggtcgcaattaaaacatgtaaaaactgtacttcggacagc
gtgcgagagaaattccttcaagaagccttaacgatgcgccagtttgaccacccccacatt
gtgaagctggtcggtgtcatcacggagaaccccgtctggataatcatggagctgtgcaca
cttggagagctgaggtcgtttctgcaagtgaggaagtacagtttggatctcgcgtctttg
atcctgtatgcctatcagcttagtacagctctggcgtatctggagagcaaaagattcgtg
cacagggacattgctgctcggaatgttctggtgtcctcaaatgattgcgtaaaattagga
gacttcggattatcccggtatatggaagacagtacttactacaaagcttccaaaggaaag
ttgcctattaaatggatggctccagagtccatcaactttcgacgttttacctcagccagt
gacgtgtggatgttcggtgtgtgtatgtgggagatactgatgcatggtgtgaagccgttt
caaggagtgaagaacaatgatgtgatcggtcgaatcgagaacggggagagattaccaatg
cctccaaattgccctcccaccctctacagccttatgacgaaatgctgggcctatgacccc
agcaggcggccccggttcactgagctcaaagctcagctcagcaccatcctggaggaggag
aaggttcagcaagaagaacgaatgaggatggaatcccgaagacaggtcacagtgtcctgg
gactccggagggtccgacgaagcgccacccaagcccagcagacctggttaccccagtcca
cggtccagcgaaggattttatcccagtccccagcacatggtacagaccaatcattaccag
gtgtctggctatcctggctcacatggggtcacagccacggctggcagcatctacccgggt
caggcatctcttttggaccagacggactcatggaatcacagaccacaggagatatcgatg
tggcagcccaacgtggaggactctgcggccctggacctgcgcgggatcgggcaggtgctg
cccacccagctggtggaagagcggctgatccggcagcagcaggaaatggaggaggaccag
cgctggctcgagaaagaggagagattcctggtcatcctgaaacccgacgtgcggctctct
cgaggcagcatcgacagggaggacgggagtcttcagggcccgacgggaaaccaacacatc
tatcagcctgttggtaaaccagatcccgcagctccgccaaagaaaccgccgcggcctgga
gcccccggtcacctgggcagcctcgccagcctcagcagccccggggacagttacaacgag
ggcgtcaagccatggaggcttcagccccaggaaatcagccccccgcccactgccaacctg
gaccggtccaacgacagggtgtacgagaatgtgacgggcctggtgaaggctgtcatcgaa
atgtccagcaagatccagccagcccccccggaggagtacgttcccatggtgaaggaagtc
ggcctggccctgcggacattactggccaccgtggacgagacccttccggtcctgccagcc
agcactcaccgagagatcgagatggcccagaagctgttgaactccgacctgggcgagctc
atcaacaagatgaagctggcccagcggtgcgccatgaccagcctgcagcaggaccacaag
aagcagatgctgaccgccgcccacgccctggccgtggacgccaagaacttactcgacgtc
atcgaccaggccagactgagggcactcggacacgcgaggccgcgctga

DBGET integrated database retrieval system