KEGG   Felis catus (domestic cat): 101095973Help
Entry
101095973         CDS       T02385                                 

Gene name
EIF2AK3
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05160  Hepatitis C
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101095973 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101095973 (EIF2AK3)
   04137 Mitophagy - animal
    101095973 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    101095973 (EIF2AK3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095973 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101095973 (EIF2AK3)
  09172 Infectious disease: viral
   05162 Measles
    101095973 (EIF2AK3)
   05160 Hepatitis C
    101095973 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    101095973 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095973 (EIF2AK3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101095973 (EIF2AK3)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   101095973 (EIF2AK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PQQ_2 Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 101095973
NCBI-ProteinID: XP_019683111
Ensembl: ENSFCAG00000012715
Position
A3
AA seq 1114 aa AA seqDB search
MERATRPGPLVRALLLLQLLLGLAAGTVAAGRAPDLPAPKVEAAFGLGAAAAPTSAARVP
AAGAVAAAEVTVEDAEAVPAAAVEQEPREPEPDDEAELQPRGRSLVIISTLDGRIAALDP
ENRGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDNDEMEQEDILLLQRS
QKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTLKPSGNKEGSKIISDVEEQ
EAAMMDTVIKVSVADWKVMAFNKKGGHLEWEYQFCTPIASAWLVKDGKVIPISLFDDTSY
ASNDEVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPTSPKALESVNNEY
AIVPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGYY
LPYYKRERSKRSTQITVRFLDNPNYNKNIRKKDPVLLLHWWKEIVGTILFCIIATTFIVR
RLFHPHPHRQRKESETQCQTESKYDSVSGDAKDSSWNDIKNSGYISRYLTDFEPVQCLGR
GGFGVVFEARNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLDHPGIVRYFNAWLEA
PPEKWQEKMDEIWLKDESTDWPLSSPSPVDGPSVKICRMDPFSTKEHIEIIAPSSQRRSF
SVGISCGQTSSSESQFSPLELSGTNHGDTSESVDAAYNLQDSCLTECDMEDGTMDGNEEG
HSFELCPSEASLYGRSRERTSSSIVFEDSGCDNASRKEEHKTDRLHIGNHCANKLTPFKH
SSSKSSSEPTFSISPPRPTTLSLDLTKNTAEKLQPSSPKVYLYIQMQLCRKENLKDWMNS
RCTIEERERSMCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTVDDVVKVGDFGLVTAM
DQDEEEQMVLTPMPACARHTGQVGTKLYMSPEQIHGSNYSHKVDIFSLGLILFELLYPFG
TQMERVRILTDVRNLKFPPLFTQKYPREYVMVQDMLSPSPMERPEATNIIENAVFEDLEF
LGKTVLRQRSRSMSSSGTKHSRHCSSSWSPLPST
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccacccgcccggggccgctcgtgcgggcgctgctgctgctgcagctgctg
ctggggctcgcggctggcacggtggccgcagggcgcgcccccgacctccccgcgccgaag
gtggaggcggcgttcggcctgggcgccgcggccgctcccacttcagcagcgcgggtgccg
gctgcgggggccgtggctgcggccgaggtgacggtggaggacgccgaagcagtgccggcg
gccgcggtcgagcaggagccgcgggagccggagcccgacgacgaggccgagctacagccg
cgaggcagatcattagtgatcatcagcactttagatgggcgaattgctgccttggatcct
gagaatcgtggtaaaaaacagtgggatttggacgtgggatccggctccttggtttcatcc
agcctcagcaaaccagaggtatttgggaataagatgatcattccttccctggatggagac
ctctttcagtgggaccgggaccgtgagagcatggaaaccgttccttttacagttgaatca
cttcttgaatcttcttataaatttggagacgatgttgttttggttggaggaaagtctctc
actacatacggactcagtgcatatagtggaaaggtgaggtatatctgctcagctctgggt
tgtcgccagtgggataatgatgaaatggaacaagaagacatcctgcttctgcagcgctcc
cagaaaaccgttagagctgttggacctcgcagtggcaatgagaagtggaatttcagtgtt
ggccactttgaacttcggtatattccagacatggaaactagagccggatttattgaaagc
accttaaagcccagtgggaacaaagaagggtctaaaattatttcagatgtggaagaacag
gaagctgccatgatggacacagtgataaaggtgtcggttgcagactggaaggttatggcg
tttaataagaagggaggacatctggaatgggaataccagttttgtactcccattgcatct
gcctggttggttaaggacggaaaagtcattcccatcagtctttttgatgatacaagttat
gcatctaatgatgaagttttagaagatgaagaagacattgtagaagctgctcgaggagcc
acagaaaacagcgtttacttgggaatgtacagaggtcagctgtatctgcagtcatcagtc
agaatttcagaaaagtttcctacaagtcccaaggccttggaatctgtcaataatgaatat
gcaattgttcctttgccaacaatcaaatggaagcccttaattcattccccgtccagaact
cctgtcttggtagggtctgatgaattcgacaaatgtcttagcaacgataagttttctcac
gaagagtacagcaacggtgcgctttcaatcttgcaatacccatatgataatggttattac
ctaccatactacaagagggagaggagcaaacggagcacacagatcacagtccgatttctc
gataacccaaattacaacaagaacattcgcaaaaaggatcccgttctcctcttacactgg
tggaaagaaatagtcggaactattctattttgtatcatagcaacaacttttatcgtgcgt
aggcttttccatcctcatcctcacagacaaaggaaggaatcggaaactcagtgtcagact
gaaagtaaatacgattctgtaagtggagacgccaaggacagtagctggaatgacataaaa
aattctggatatatatcgcgatatctaacagattttgagccggttcagtgcctgggacgc
ggtgggtttggagttgtctttgaagccagaaataaagttgatgactgcaattatgctatc
aagagaatccgtctccccaacagggaattggctcgggaaaaggtaatgcgagaagttaaa
gccttagccaagcttgaccatccaggaattgtgagatatttcaatgcttggttggaggca
ccaccagagaagtggcaagaaaaaatggatgaaatctggctgaaagatgaaagcacagac
tggccactcagctctcctagtccagtggatggaccatccgttaaaatatgcagaatggac
cctttctctacaaaggaacatattgagatcatagctccttcttcacaaaggagatctttt
tcagtagggatttcctgtggccagacaagttcatctgagagccagttctctccactggaa
ttatcaggaacgaaccacggagataccagtgaatcagtggatgcagcctacaacctccag
gacagttgccttacagagtgtgatatggaagacggtaccatggacggcaatgaggagggg
cactcctttgaactttgtccttctgaagcttctctttatggaaggtcaagggagcgaaca
tcctcttctatagtgtttgaagactctggctgcgataatgcatccaggaaagaagagcac
aaaactgaccgcctgcatattggcaaccattgtgctaataaactgactcctttcaagcat
tccagtagcaaatcttcttccgaacctaccttctctatttctcctccaagaccgaccact
ttgagtttagatctcactaaaaacactgcagaaaagctccagcccagttcaccgaaggta
tatctttacattcagatgcagctgtgcagaaaggaaaacctcaaagactggatgaacagt
cggtgcaccatagaggagagagagaggagcatgtgtctgcacatcttcctgcagatcgca
gaggccgtagagtttctgcacagtaaagggctcatgcacagggacctcaagccttccaac
atattctttacagtggacgatgtggtcaaggtcggagactttggactagtgactgcaatg
gaccaggacgaggaagagcagatggttctgaccccaatgccagcgtgtgccagacacaca
ggacaagtagggaccaaactgtatatgagcccagagcagattcatggaagcaactactct
cataaagtggacatcttttctttaggcctcattctgtttgaactgctgtacccattcggc
actcagatggagagagtcaggatcttaactgatgtaagaaatctcaaatttccaccactg
tttactcagaaatatcctcgtgagtatgtgatggttcaagacatgctctctccatccccc
atggaacggcctgaagctaccaacattattgaaaatgctgtattcgaagacttggaattt
ctaggaaaaactgtactcagacagaggtctcgctccatgagttcatcaggaacaaaacat
tcaagacactgcagcagctcctggagccctttgccaagcacttag

DBGET integrated database retrieval system