KEGG   Felis catus (domestic cat): 101096463Help
Entry
101096463         CDS       T02385                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00220  Arginine biosynthesis
fca00330  Arginine and proline metabolism
fca01100  Metabolic pathways
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04066  HIF-1 signaling pathway
fca04071  Sphingolipid signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04611  Platelet activation
fca04915  Estrogen signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04931  Insulin resistance
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101096463 (NOS3)
   00330 Arginine and proline metabolism
    101096463 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101096463 (NOS3)
   04371 Apelin signaling pathway
    101096463 (NOS3)
   04066 HIF-1 signaling pathway
    101096463 (NOS3)
   04020 Calcium signaling pathway
    101096463 (NOS3)
   04071 Sphingolipid signaling pathway
    101096463 (NOS3)
   04022 cGMP-PKG signaling pathway
    101096463 (NOS3)
   04151 PI3K-Akt signaling pathway
    101096463 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101096463 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101096463 (NOS3)
   04921 Oxytocin signaling pathway
    101096463 (NOS3)
   04926 Relaxin signaling pathway
    101096463 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101096463 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101096463 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101096463 (NOS3)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101096463 (NOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Motif
Other DBs
NCBI-GeneID: 101096463
NCBI-ProteinID: XP_003983267
Ensembl: ENSFCAG00000013191
Position
A2
AA seq 1203 aa AA seqDB search
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPTAEPGRAPAPAPPPPPAPDRSSPPLT
KPPEGPKFPRVKNWEVGSITYDTLSAQAQQEGPCTPRRCLGSLVFPRKLQSRPSQDPPPT
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEIAAAGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCNSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPP
ELFALPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFHYQPDPW
KGSGSKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHRSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAA
RDIFSAKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKMFQATILSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGSPGGP
PPSWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEESGEQQELESLSQDPRRY
EEWKWFRCPTLLEALEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIDSKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSRE
PDCPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDPPGPDT
PSP
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatttgaagagtgtgggccaggagccggggcctccctgcggcctggggctgggg
ctgggcctgggcctgtgcggcaagcagggcccagcctccccgacagcagagcccggcagg
gcaccggcacccgcacccccacccccacccgcgccagaccgcagcagtcccccgctcacc
aagcccccggaggggcccaagttccctcgtgtgaagaactgggaggtggggagcatcact
tacgacaccctgagtgcccaggcacagcaggaggggccctgcacccctagacgctgcctg
ggctccctggtttttccacggaaactgcagagccggccctcccaggacccaccacccact
gagcagctgctgagccaggccagggacttcatcaaccagtactacagctccatcaagagg
agtggctcccaggcccatgagcagaggcttcaggaggtggaagccgagatagcagccgca
ggcacataccagcttcgggagagcgagctggtgttcggggctaagcaggcttggagaaat
gcaccccgctgcgtgggccggatccagtgggggaagctgcaggtgtttgatgcccgggat
tgcaactctgcccaggagatgttcacctacatctgcaaccacatcaagtacgccaccaac
cggggcaacctccgctcggccatcacagtgttcccccagcgcgccccaggccgcggagac
ttccgaatctggaacagccaactggtgcgctacgcggggtacaggcagcaggatggctcc
gtgcggggggacccagccaacgtggagatcactgagctctgcatccagcacggctggacc
ccaggaaacggccgctttgatgtactgcccctactgctccaggccccagatgagccccca
gaactctttgccttgccccccgagctggtcctcgaggtgcccctggagcaccccacgctg
gagtggtttgcggccctgggcctgcgctggtacgccctcccggcggtgagcaacatgctg
ctggaaattggggggctggagttccccgcggcccctttcagcggctggtacatgagcact
gagatcggcacgcggaacctgtgtgacccgcaccgatacaacatcctggaggatgtggcc
gtctgcatggacttggatacccggaccacctcgtccctgtggaaagacaaggcagccgtg
gaaatcaacttggctgtgctgcacagttaccagctggccaaagtgaccattgtggaccac
catgctgccacggcctccttcatgaagcacctggagaatgagcagaaggctagggggggc
tgccctgccgactgggcctggatcgtgccccccatctccggcagcctcacccctgtgttc
catcaggagatggtcaactatgtcctgtcccctgccttccactatcagccagacccgtgg
aagggaagtgggtccaagggtgccggcatcaccaggaagaagacctttaaggaagtggcc
aatgcggtgaagatctctgcctcactcatgggcaccgtgatggcaaagcgagtaaaggca
acaatcctgtatggctccgagaccggccgggcccagagctatgcacagcagctggggaga
ctcttccggaaggctttcgatccccgggtcctgtgcatggatgagtatgatgtcgtgtcc
ctcgagcatgagacgctagtgctggtcgtgaccagcacattcgggaacggtgatcccccc
gagaatggagagagttttgcagcggccctgatggaaatgtctggtccctacaacagctcc
cctcggccagaacaacacaggagttacaaaatccgcttcaacagtgtctcctgctcagac
ccgctggtgtcctcctggaggcggaagagaaaggagtccagtaacacagacagtgcaggg
gcactgggtaccctcaggttctgtgtgttcgggctgggctcccgggcgtacccccacttc
tgtgcctttgcccgtgcggtggacacacggctggaggagctaggtggcgagcggctgctg
cagctgggccagggagatgagctgtgtggccaggaggaggccttccgtggctgggcccag
gccgccttccaggcctcctgtgagactttctgcgtgggagaggacgccaaggctgccgcc
agggacatattcagcgccaaacggagctggaagcgccaaaggtaccggctcagcacccag
gcggagggcctccagctgctgccaggcctgatccacgtgcacaggaggaagatgttccag
gctaccatcctctcagtcgaaaacctgcaaagcagcaagtccacccgggccacgatcctg
gtgcgcctggacactggaggccaggaggggctgcagtaccagccgggggaccacataggc
atctgcccgcccaaccgaccgggcctcgtggaggcgctgctgagccgtgtggaggacccg
cctccgccaggagagcccgtggccgtggagcagctggagaagggcagccctggtggccca
ccccccagctgggttcgggacccccggctgcccccctgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccgcccagccctcaactccttcgactgctcagcaccctg
gcggaagagtccggagaacagcaggagctggagagcctcagccaggacccccggcgctac
gaggagtggaagtggttccggtgccccacgctgctggaggcgctggaacagttcccgtcc
gtggcgctgcctgcccccctgctcctcacccagctgcccctgctccagccccggtactac
tccgtcagctcggcgcccagcgcccacccgggagagattcacctcacggtggccgtgctg
gcgtacaggacccaggatggactgggccccctgcactatggagtctgctccacatggctg
agccagctgaaggccggagatcccgtaccttgcttcatcaggggggctccctccttccgg
ctgccgcctgatcccagcttgccctgcatcctagtgggccctggcacaggaattgccccc
ttccggggattttggcaggagcggctgcacgacattgacagcaaagggctgcagccggcc
cccatgaccttggtgttcggctgccgatgctcccagctcgaccacctctaccgcgacgag
gtgcaggatgcccagcagcgcggggtttttggacgcgtcctcacagccttctctcgggag
cccgactgccctaagacctacgtgcaggacatcctgcggacggagctggcggctgaggtg
caccgcgtgctgtgcctcgagcggggccacatgtttgtgtgcggcgacgtcaccatggca
accagcgtcctgcagacggtgcagcgaatcctagcgacggagggcgacatggagctggac
gaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggacattttc
gggctcacgctgcgcacccaggaggtcactagccgcatacgcacccagagcttttccctg
caggagcggcatctgcgcggcgcagtgccctgggcgttcgaccctcccggcccagacacc
cccagtccctga

DBGET integrated database retrieval system