KEGG   Felis catus (domestic cat): 101096622Help
Entry
101096622         CDS       T02385                                 

Gene name
GEMIN7
Definition
(RefSeq) gem-associated protein 7 isoform X1
  KO
K13135  gem associated protein 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca03013  RNA transport
Module
fca_M00426  Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101096622 (GEMIN7)
Spliceosome [BR:fca03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    101096622 (GEMIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gemin7 SUZ-C
Motif
Other DBs
NCBI-GeneID: 101096622
NCBI-ProteinID: XP_019674930
Ensembl: ENSFCAG00000001767
Position
E2
AA seq 147 aa AA seqDB search
MACLPVLCGLPAKTRIMQTPPAIPVPVLRLPRGPDGLSRGFAPDGRRAPPKPEAPGSPGS
PAGRESRESREQRVRAALRERYLRSLLAMVGHQVNFTLHEGVHVTAHFGAADLDVANFYV
LQLQTPIGVQAEALLRCSDIISYTFKP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctcccggtcttgtgtggcctgccagccaagaccaggataatgcagactcca
ccagccattcctgtgcctgtgctccggctcccccggggccctgatggcttgagccgaggc
tttgccccagacggacgcagggcccccccgaagccagaggctcctggaagcccgggatct
ccagcaggtcgagagtctcgggaatcccgggaacagcgggtccgagccgcacttcgggaa
cgctacctccgcagcctgctggccatggtgggtcaccaggtgaacttcacactgcacgag
ggtgtgcacgtgaccgcccacttcggagccgccgacctggacgtggccaacttctacgtg
ctgcagctgcagacgccgataggcgtgcaggccgaggcgctgctgcggtgtagtgacatt
atttcctacaccttcaagccgtga

DBGET integrated database retrieval system