KEGG   Felis catus (domestic cat): 101096739Help
Entry
101096739         CDS       T02385                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101096739 (TRAF3)
   04668 TNF signaling pathway
    101096739 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101096739 (TRAF3)
   04621 NOD-like receptor signaling pathway
    101096739 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    101096739 (TRAF3)
   04657 IL-17 signaling pathway
    101096739 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101096739 (TRAF3)
   05203 Viral carcinogenesis
    101096739 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101096739 (TRAF3)
  09172 Infectious disease: viral
   05162 Measles
    101096739 (TRAF3)
   05164 Influenza A
    101096739 (TRAF3)
   05161 Hepatitis B
    101096739 (TRAF3)
   05160 Hepatitis C
    101096739 (TRAF3)
   05168 Herpes simplex virus 1 infection
    101096739 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101096739 (TRAF3)
   05169 Epstein-Barr virus infection
    101096739 (TRAF3)
   05165 Human papillomavirus infection
    101096739 (TRAF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 MPS2 zf-C3HC4_2 Spc7 Spc29 Tropomyosin_1 T3SSipB FliJ KxDL DUF1664 BLOC1_2 zf-RING_6 DUF3450 LMBR1 SPATA24
Motif
Other DBs
NCBI-GeneID: 101096739
NCBI-ProteinID: XP_003988052
Ensembl: ENSFCAG00000010003
UniProt: A0A2I2UTY9
Position
B3
AA seq 568 aa AA seqDB search
MEPSKKMESPGTLQTNPPLKLHPDRGAGTSVFVPEQGGYKERFVKTVEDKYKCEKCRLVL
CNPKQTECGHRFCETCMAALLSSSSPKCTACQEGIIKDKVFKDNCCKREILALQIYCRNE
GGGCTEQLTLGHLLVHLKNDCQFEELSCVRADCKEKVLRRDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagccaagtaaaaagatggaatcccccggcacactgcagacgaacccgccgctgaag
ctgcaccctgaccgcggcgccgggacgtccgtgttcgtccccgagcaaggaggttacaaa
gaaaggtttgtgaagaccgtggaggacaagtacaagtgcgagaagtgccgcctggtgctg
tgtaacccgaagcagacggagtgcggacaccggttctgtgagacctgcatggcggccctg
ctgagctcctccagcccaaaatgtaccgcgtgtcaagaaggcatcatcaaagataaggtg
tttaaggataattgctgcaagagagagattctggctcttcagatctactgcaggaacgag
ggcgggggctgcacggagcagttgaccctgggacacctgctggtgcatttaaagaatgat
tgccagtttgaagagctgtcgtgtgtccgcgctgactgcaaagagaaagtgttgagaaga
gacctgcgtgaccacgtggaaaaggcctgcaagtaccgggaggccacgtgcagccactgc
aaaagtcaggtcccgatgatcacgctgcagaaacacgaagacactgagtgtccctgtgtg
gtggtgtcctgcccccataagtgcagtgtccagacccttctgaggagtgagttgagtgcg
cacttgtcagagtgcgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtg
tttcaggggacaaaccagcagattaaggcccatgaggccagctccgcggtgcagcacgtc
aacttactgaaagagtggagtaattctctggagaaaaaggtttccttgctacagaatgaa
agtgtagaaaaaaacaagagcatacaaagtctgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaacaatgaatccaaaatacttcatttacag
cgggtaatagacagccaggcggagaaattgaaagagcttgacaaagagatccgcccgttc
cggcagaactgggaagaagcggacagcatgaagagcagcgtggaatccctccagaaccga
gtgaccgagctggagagtgtggacaaaagcgccgggcaggcggctcggaacacaggcttg
ctggagtcccagctgagccggcacgaccagatgctgagcgtccacgacatccgcctggcc
gacatggatctgcgcttccaggttctggagaccgccagctacaatggcgtgctgatctgg
aagatccgagattacaagcggcggaagcaggaagccgtcatggggaagaccctgtccctt
tacagccagcctttctacacgggctattttggctataagatgtgtgccagggtctacctg
aacggggatggcatgggcaaggggacgcatctgtcgctgttttttgtcatcatgcgtgga
gaatacgatgctctgcttccttggccgttcaagcagaaagtgacactcatgctgatggat
caggggtcctctcggcgtcacctgggagacgcgttcaagccggaccccaacagcagcagc
ttcaagaaacccaccggggagatgaatatcgcctccggctgcccggtgtttgtggcccaa
actgtgctagaaaacgggacatatattaaagatgataccatttttattaaagtcatagtg
gatacttcggatctgcctgacccctga

DBGET integrated database retrieval system